Recombinant Drosophila persimilis Calcium channel flower (flower)

Shipped with Ice Packs
In Stock

Description

Biological Function of Flower Proteins

Flower proteins are implicated in calcium-dependent synaptic vesicle (SV) dynamics and phosphatidylinositol 4,5-bisphosphate (PI(4,5)P₂) compartmentalization:

Role in Calcium Signaling and Endocytosis

  • Positive Feedback Loop with PI(4,5)P₂: Flower promotes PI(4,5)P₂ enrichment at periactive zones via Ca²⁺ influx, enhancing its own channel activity and SV recycling .

  • Activity-Dependent Bulk Endocytosis (ADBE): Flower facilitates ADBE during intense neurotransmission, enabling SV reformation from bulk endosomes .

  • Debate on Calcium Channel Activity: While sequence similarities suggest Flower may act as a calcium channel , its slow kinetics and low Ca²⁺ conductance raise questions about its primary role in endocytosis .

Functional Implications in Drosophila and C. elegans

OrganismKey FindingsSource
D. melanogasterFlower localizes to SVs and periactive zones; loss disrupts SV recycling .
C. elegansLoss of FLWR-1 (homolog) increases neuronal excitability and GABA release .

Research Applications

  • Structural Studies: His-tagged recombinant proteins enable crystallization or cryo-EM analysis to resolve Flower’s transmembrane architecture .

  • Functional Assays: Used to study Flower’s interaction with PI(4,5)P₂ or calcium channel activity in vitro .

Handling Recommendations

  • Storage: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Resuspend in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Working Aliquots: Store at 4°C for ≤1 week .

Research Gaps and Future Directions

  • Species-Specific Data: No direct data on D. persimilis Flower exists in the provided sources. Comparative studies across Drosophila species are needed to identify conserved or divergent mechanisms.

  • Mechanistic Clarification: Further investigation into Flower’s calcium channel activity versus its role as a signaling scaffold is critical .

  • Therapeutic Potential: Mammalian Flower homologs’ role in tumor suppression suggests potential applications in oncology, warranting cross-species validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
flower; GL24930; Calcium channel flower
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Drosophila persimilis (Fruit fly)
Target Names
flower
Target Protein Sequence
MSFAEKITGLLARPNQQDPVGGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVLSIITLSV SCLVAGIIQMIAGFIVMVLEAPCCFVCIEQVNGIADKVDAKPMYFRAGLYCALAVPPIFM CFGLASLFGSGLIFATGAVYAMMALGKKASAEDMRAAAQQTGYGGNGTAASTTNDRAGIV NNAQPFSFTGAVGTDSNV
Uniprot No.

Target Background

Function

A calcium channel regulating synaptic endocytosis, thus coupling exo- and endocytosis. It is essential for nervous system function and is required in photoreceptor cells.

Database Links
Protein Families
Calcium channel flower family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.

Q&A

How does the flower protein function in calcium signaling pathways?

The flower protein participates in calcium-dependent regulatory processes in Drosophila neurons, particularly in synaptic transmission. While not the primary voltage-gated calcium channel (which is encoded by the cacophony gene in Drosophila), flower contributes to calcium homeostasis and signaling .

Research indicates that flower proteins function in concert with other calcium channel subunits to regulate calcium influx during neuronal activity. These proteins are critical for processes including neurotransmitter release, as calcium serves as the trigger for regulated neurotransmitter release at synapses . The precise mechanism involves calcium-dependent exocytosis of synaptic vesicles, where calcium channel complexes create localized increases in calcium concentration at active zones.

How conserved is the flower protein sequence across Drosophila species?

Comparative analysis of flower protein sequences across different Drosophila species reveals both conservation and divergence. When comparing D. persimilis flower protein (198 amino acids) with that of D. simulans (194 amino acids), significant homology is observed with discrete species-specific variations :

SpeciesProtein LengthKey Sequence Differences
D. persimilis198 aaContains sequence "GYGGNGTAASTTNDRAGIV"
D. simulans194 aaContains sequence "FGGNTPAQTNDRAGIV"

These differences, particularly in the C-terminal region, may contribute to species-specific functions or interactions with other proteins . Sequence alignment studies across multiple Drosophila species show that the transmembrane domains and calcium-binding regions are generally more conserved than the cytoplasmic domains, suggesting functional constraints on regions directly involved in ion transport.

What can chromosomal arrangements tell us about the evolution of the flower gene in D. persimilis?

D. persimilis and its sister species D. pseudoobscura differ by three fixed chromosomal inversions, which play a significant role in reproductive isolation between these species . These inversions may impact the evolutionary trajectory of genes located within or near the inversion breakpoints.

Research on chromosomal arrangements suggests that genes within inversion regions experience reduced recombination when hybridization occurs . For genes like flower, their evolutionary history may be influenced by their chromosomal position relative to these inversions. If the flower gene is located within one of these inversions, it may show accelerated divergence between D. persimilis and D. pseudoobscura compared to genes in collinear regions .

Phylogenetic analysis methods can determine whether the flower gene experienced divergent selection during speciation between D. persimilis and D. pseudoobscura by examining sequence variation patterns within and between species .

What expression systems are optimal for producing functional recombinant flower protein?

For functional studies, researchers should consider:

  • Eukaryotic expression systems: Insect cell lines (S2, Sf9) often provide better folding and post-translational modifications for Drosophila proteins.

  • Mammalian expression systems: HEK293 or CHO cells may be suitable for structural studies requiring mammalian-type glycosylation.

  • Cell-free expression systems: These can be optimized for membrane protein production with the addition of lipid vesicles during translation.

Successful expression typically requires optimization of coding sequence (codon optimization), temperature, induction conditions, and the addition of chaperones to improve folding of this multi-transmembrane domain protein.

What functional assays can be used to assess flower protein activity?

Functional characterization of the flower calcium channel protein can be approached through multiple complementary techniques:

  • Calcium imaging: Using fluorescent calcium indicators (e.g., Fura-2, rhod-2) to measure changes in intracellular calcium in cells expressing flower protein .

  • Electrophysiology: Patch-clamp recordings to directly measure calcium currents through channels containing flower protein, particularly in temperature-sensitive mutants to assess conditional function .

  • Synaptic vesicle trafficking assays: Using FM1-43 dye to label endocytosed vesicular structures and monitor calcium-dependent vesicle recycling .

  • Rescue experiments: Transgenic expression of wild-type flower cDNA in flower mutant backgrounds to assess functional rescue, similar to approaches used with cacophony calcium channel mutants .

  • Protein-protein interaction studies: Co-immunoprecipitation or proximity labeling methods to identify binding partners that form functional calcium channel complexes with flower.

How do mutations in the flower gene affect neural development and function?

Mutations in calcium channel genes in Drosophila, including those affecting the flower protein, can have profound effects on neural development and function. While specific flower mutant phenotypes are less documented than mutations in the primary cacophony calcium channel, research on related calcium channel components provides insights :

  • Synaptic transmission: Conditional mutations (temperature-sensitive) allow acute perturbation of calcium channel function, revealing defects in neurotransmitter release.

  • Behavioral phenotypes: Mutations may lead to abnormal locomotion, paralysis (especially temperature-dependent), and altered sensory responses.

  • Developmental effects: Calcium signaling disruptions can affect neuronal migration, axon guidance, and synapse formation during development.

Research methodologies to characterize these phenotypes include electrophysiological recording at neuromuscular junctions, calcium imaging in vivo, and behavioral assays measuring locomotion and sensory responses.

What is the relationship between flower protein function and programmed cell death in Drosophila?

Evidence suggests that the flower protein may participate in calcium-dependent apoptotic pathways in Drosophila . The precise mechanisms involve:

  • Cell competition: The flower protein may mark cells for elimination through a process called cell competition, where less fit cells are removed from developing tissues.

  • Calcium signaling in apoptosis: Calcium flux regulated by channels including flower can trigger mitochondrial permeabilization and subsequent caspase activation in the apoptotic cascade.

  • JAK/STAT pathway interaction: Research indicates potential crosstalk between calcium signaling and the JAK/STAT pathway in regulating programmed cell death in specific developmental contexts .

Experimental approaches to study this relationship include genetic screens for suppressors and enhancers of flower-related phenotypes, live imaging of calcium dynamics during developmental apoptosis, and epistasis analysis with known apoptotic pathway components.

How can protein engineering be used to modify the ion selectivity of recombinant flower protein?

Engineering the ion selectivity of calcium channel proteins like flower requires precise modification of the pore-forming regions. Advanced approaches include:

  • Site-directed mutagenesis: Targeting conserved glutamate residues in the selectivity filter that coordinate calcium ions. Substituting these with lysine or arginine can alter selectivity for divalent versus monovalent cations.

  • Domain swapping: Replacing segments of the pore region with corresponding regions from channels with different selectivity profiles.

  • Computational modeling and simulation: Using homology models based on crystallized calcium channels to predict the effects of mutations on ion coordination and selectivity.

  • High-throughput screening: Combining random mutagenesis with functional selection to identify novel selectivity-altering mutations.

Functional assessment of engineered channels requires electrophysiological characterization in heterologous expression systems, measuring reversal potentials and comparing permeability ratios for different cations.

What role does alternative splicing play in generating functional diversity of flower calcium channels?

Alternative splicing is a key mechanism for generating functional diversity in ion channels, including calcium channels in Drosophila. For the flower gene:

  • Exon mapping: RNA-seq and RT-PCR analyses can identify alternatively spliced exons in different tissues and developmental stages.

  • Isoform-specific functions: Different splice variants may show tissue-specific expression patterns or altered biophysical properties (activation/inactivation kinetics, voltage dependence).

  • Evolutionary conservation: Comparative genomics across Drosophila species can reveal conserved alternative splicing patterns, suggesting functional importance.

The cacophony (cac) gene in Drosophila shows extensive alternative splicing and RNA editing that modifies channel function . Similar mechanisms may operate for the flower gene, potentially generating tissue-specific channel variants with specialized properties.

What are the optimal solubilization and purification strategies for maintaining flower protein activity?

As a multi-transmembrane protein, flower presents significant challenges for solubilization and purification while preserving native structure and function:

  • Detergent screening: Systematic testing of detergents including mild non-ionic (DDM, LMNG) and zwitterionic (CHAPS, Fos-choline) options to identify optimal solubilization conditions.

  • Purification strategy:

    • Initial IMAC purification using the His-tag

    • Size exclusion chromatography to remove aggregates

    • Optional affinity purification with calcium-dependent binding partners

  • Stabilization approaches:

    • Addition of lipids during purification (bicelles or nanodiscs)

    • Use of calcium or calcium mimetics to stabilize conformation

    • Incorporation of protein-specific antibody fragments

  • Activity assessment: Developing functional assays compatible with detergent-solubilized protein, such as calcium flux measurements in proteoliposomes.

How can single-molecule techniques be applied to study flower protein dynamics?

Advanced single-molecule techniques offer powerful approaches to understanding flower protein dynamics:

  • Single-molecule FRET: By labeling specific domains with fluorophore pairs, conformational changes during calcium binding and channel gating can be monitored in real-time.

  • Atomic Force Microscopy: Provides insights into protein topology and mechanical properties of the channel in membrane environments.

  • Total Internal Reflection Fluorescence (TIRF) microscopy: Can monitor individual fluorescently-labeled channels in artificial membranes to assess opening probability and calcium flux events.

  • Cryo-electron microscopy: While challenging for smaller membrane proteins, advances in cryo-EM now make it possible to determine structures of challenging membrane proteins like calcium channels.

Implementation requires careful protein engineering to introduce specific labeling sites without disrupting function, validation of labeled protein activity, and sophisticated imaging setups with high temporal and spatial resolution.

How does the flower protein from D. persimilis compare functionally to orthologs in other insects?

Comparative functional analysis between D. persimilis flower protein and orthologs from other insects requires:

  • Heterologous expression: Expressing flower proteins from multiple species in the same cellular background to directly compare functional properties.

  • Electrophysiological characterization: Patch-clamp recordings to assess differences in:

    • Voltage dependence of activation/inactivation

    • Calcium conductance and selectivity

    • Modulation by second messengers

  • Cross-species rescue experiments: Testing whether flower orthologs from different species can functionally substitute for each other in vivo.

Studies should focus particularly on comparisons between closely related species with known ecological or behavioral differences that might correlate with calcium signaling properties, such as D. persimilis and D. pseudoobscura which show significant reproductive isolation .

What can we learn by studying flower protein function in the context of speciation between D. persimilis and D. pseudoobscura?

D. persimilis and D. pseudoobscura represent a valuable model system for studying speciation, with evidence that chromosomal inversions play a key role in maintaining species barriers . Studying flower protein in this context offers unique insights:

  • Sequence divergence analysis: Comparing coding and regulatory sequences between species to identify signatures of selection.

  • Expression pattern differences: Assessing whether flower expression differs between species in ways that might contribute to reproductive isolation.

  • Hybrid incompatibility: Testing whether differences in calcium channel function contribute to the known hybrid male sterility between these species .

  • Introgression analysis: Using naturally occurring hybridization between these species to track the movement of flower alleles across species boundaries and test for selection against hybrid combinations.

Research has demonstrated that F1 hybrid males between D. persimilis and D. pseudoobscura show chromosome pairing problems during meiosis, leading to sterility . Investigating whether calcium signaling differences contribute to this hybrid incompatibility could provide novel insights into speciation mechanisms.

How can CRISPR/Cas9 genome editing be optimized for studying flower protein function in Drosophila?

CRISPR/Cas9 offers powerful approaches for investigating flower protein function:

  • Knock-in strategies: Creating precise modifications such as:

    • Endogenous tagging with fluorescent proteins to study localization

    • Introduction of specific mutations to test structure-function hypotheses

    • Insertion of recombination sites for conditional knockout

  • Guide RNA design considerations:

    • Minimize off-target effects by careful guide selection

    • Use paired nickases for increased specificity

    • Consider chromatin accessibility at the target locus

  • Homology-directed repair optimization:

    • Design optimal homology arm lengths (typically 500-1000bp)

    • Use Cas9 variants with higher fidelity

    • Consider cell cycle synchronization to increase HDR efficiency

  • Phenotypic analysis pipeline:

    • Calcium imaging in specific neurons

    • Electrophysiology of synaptic function

    • Behavioral assays for neural function

What are the emerging analytical techniques for studying calcium channel interactions with synaptic machinery?

Advanced analytical techniques are revealing new insights into calcium channel interactions with synaptic proteins:

  • Proximity labeling proteomics: Using engineered peroxidases (BioID, APEX) fused to flower protein to identify proteins in close proximity under various conditions.

  • Super-resolution microscopy: Techniques like STORM and PALM can localize calcium channels relative to active zone proteins with nanometer precision, revealing organizational principles.

  • Optical electrophysiology: Combining optogenetic stimulation with calcium imaging to probe channel function with high spatiotemporal resolution.

  • Correlative light and electron microscopy (CLEM): Linking functional calcium imaging with ultrastructural analysis of the same synapses.

Research on synaptic vesicle pools in Drosophila has shown distinct mechanisms for replenishing different vesicle pools depending on calcium source . These techniques can further elucidate how flower protein may participate in calcium-dependent vesicle trafficking during synaptic transmission.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.