Recombinant Drosophila persimilis Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila persimilis (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Drosophila persimilis Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by participating in a series of complexes (complex II, CII; complex III, CIII; and complex IV, CIV) that transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the Cu(A) center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) composed of heme A3 and Cu(B) in subunit 1. The BNC uses four electrons from cytochrome c and four protons from the matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (mt:CoII) in Drosophila persimilis?

Cytochrome c oxidase subunit 2 (mt:CoII) in Drosophila persimilis is a mitochondrial-encoded protein that forms part of cytochrome c oxidase (COX), which is Complex IV of the electron transport chain. This enzyme catalyzes the final step of the respiratory chain by transferring electrons from cytochrome c to molecular oxygen, reducing it to water. In D. persimilis, as in other Drosophila species, mt:CoII is encoded by the mitochondrial genome and is one of several subunits that make up the complete COX complex, which contains both mitochondrial-encoded and nuclear-encoded proteins . The protein has specific domain structures that are critical for its enzymatic function, including regions that interact with other COX subunits, particularly subunit I (COI) .

How does Drosophila persimilis mt:CoII compare with other Drosophila species?

D. persimilis mt:CoII shares significant sequence homology with other Drosophila species, reflecting its essential function in cellular respiration. Based on comparative genomic analyses:

SpeciesSequence Identity with D. persimilis mt:CoIIKey Differences
D. pseudoobscuraVery high (>95%)Limited polymorphisms, closely related species
D. melanogaster~80-85%Conserved functional domains but divergence in less critical regions
D. simulans~80-85%Similar conservation pattern to D. melanogaster
D. yakuba~75-80%Greater divergence in non-catalytic regions

The most significant differences across species tend to occur in regions not directly involved in the catalytic site or protein-protein interactions within the COX complex. Studies have shown that while there are species-specific polymorphisms, the functional domains of mt:CoII are generally well-conserved across the Drosophila genus . The pattern of conservation and divergence provides insights into the structural constraints and evolutionary pressures acting on this protein.

What is known about the functional domains of mt:CoII in Drosophila?

The functional domains of mt:CoII in Drosophila have been inferred from both sequence analysis and functional studies. Key domains include:

  • Copper-binding sites: Essential for electron transfer during oxidative phosphorylation.

  • Interaction surfaces: Regions that interface with COX subunit I, forming the core of the enzyme complex.

  • Transmembrane helices: Anchor the protein within the inner mitochondrial membrane.

Specific residues in mt:CoII are critical for function, as demonstrated by studies of mutations. For example, research on the COII G177S mutation in D. melanogaster showed that this single amino acid change, occurring in a loop where COII interacts with subunit I, results in a temperature-dependent decrease in COX enzymatic activity and specifically impairs male fertility . This glycine residue is highly conserved across metazoans, highlighting its functional importance. The conservation of such key residues in D. persimilis mt:CoII reflects similar functional constraints.

What are the optimal methods for expressing recombinant Drosophila persimilis mt:CoII?

Expression of recombinant D. persimilis mt:CoII presents several challenges due to its hydrophobic nature and mitochondrial origin. Based on current methodologies, the following expression systems have proven effective:

Expression SystemAdvantagesLimitationsYieldNotes
E. coliCost-effective, rapid growth, genetic tools availableOften forms inclusion bodies, lacks post-translational modificationsModerateRequires optimization of solubilization and refolding
Yeast (S. cerevisiae)Eukaryotic system, better folding, some post-translational modificationsSlower growth than bacteriaModerate to highGood compromise between bacterial and insect systems
Baculovirus/insect cellsNative-like post-translational modifications, better foldingHigher cost, more complex setupHighPreferred for functional studies
Mammalian cellsMost sophisticated post-translational modificationsHighest cost, complex protocols, slower growthVariableUsed when native-like activity is critical

For optimal expression, several key factors should be considered:

  • Addition of solubility tags (e.g., MBP, SUMO) to improve protein solubility

  • Codon optimization for the host expression system

  • Use of specific detergents for membrane protein extraction

  • Co-expression with chaperones to improve folding

The choice of system depends on the research goals: structural studies may prioritize yield and purity, while functional analyses require proper folding and activity .

How can researchers assess the functional activity of recombinant Drosophila persimilis mt:CoII?

Assessment of recombinant D. persimilis mt:CoII functional activity requires multiple approaches:

  • Enzymatic activity assays:

    • Cytochrome c oxidation rates measured spectrophotometrically

    • Polarographic measurements of oxygen consumption

    • NADH/succinate oxidation coupled assays

  • Structural integrity verification:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Thermal stability assays

  • Integration into functional complexes:

    • Blue native PAGE to assess complex formation

    • Co-immunoprecipitation with other COX subunits

    • Reconstitution experiments with purified components

A comprehensive functional assessment typically involves comparing the activity of recombinant mt:CoII to that of the native protein complex. For example, studies in D. melanogaster demonstrated that a 20% decrease in COX activity due to the COII G177S mutation correlated with specific phenotypic effects, providing a benchmark for functional significance . Similar approaches can be applied to D. persimilis mt:CoII to evaluate the impact of experimental manipulations or mutations.

How can recombinant mt:CoII be used to study mitochondrial genome recombination in Drosophila?

Recombinant mt:CoII serves as a valuable tool for investigating mitochondrial genome recombination in Drosophila, which, despite being rare, has significant evolutionary implications:

  • Marker-based approaches:

    • Introducing specific mutations or tags in recombinant mt:CoII that can be tracked in subsequent generations

    • Using mt:CoII variants as genetic markers to detect recombination events between mitochondrial genomes

  • Selection-based methods:

    • Designing selections that isolate recombinant mitochondrial genomes using mt:CoII alleles with differential phenotypes

    • Creating heteroplasmic Drosophila lines with distinct mt:CoII variants to monitor recombination

  • Functional complementation:

    • Expressing recombinant mt:CoII in lines with mt:CoII mutations to assess functional complementation

    • Using temperature-sensitive or conditional mt:CoII alleles to develop selective systems

Studies have successfully utilized such approaches to detect and characterize mitochondrial recombination events. For example, researchers designed selections for recombination between co-resident mitochondrial genomes in heteroplasmic Drosophila lines and found that specific mt:CoII alleles could be tracked to identify recombination events . The R301Q mt:CoII allele has been used in such studies, demonstrating the utility of specific protein variants as markers for mitochondrial recombination.

What challenges exist in distinguishing the effects of nuclear versus mitochondrial genetic variation on cytochrome c oxidase function?

Distinguishing between nuclear and mitochondrial genetic contributions to cytochrome c oxidase function presents significant challenges due to the complex interplay between these genomes:

ChallengeDescriptionMethodological Solution
Genetic linkageDifficulty separating effects of linked nuclear genesCreate cybrid models with consistent nuclear background
CoevolutionNuclear and mitochondrial genomes co-adapt over evolutionary timeComparative analysis across related species with different evolutionary histories
Background effectsPhenotypic effects of mtDNA variants depend on nuclear backgroundCross experiments with multiple nuclear backgrounds
Tissue-specific effectsMitochondrial function varies across tissuesTissue-specific assays and conditional expression systems
HeteroplasmyPresence of multiple mtDNA variants in single organismsSingle-cell or single-organelle analyses

The cybrid (cytoplasmic hybrid) approach has proven particularly effective. This involves transferring mitochondria from one genetic background to another, creating lines with identical nuclear genomes but different mitochondrial genomes. For example, studies with D. melanogaster have shown that nuclear genetic backgrounds can completely suppress the male sterility phenotype associated with the COII G177S mitochondrial mutation . This approach allows researchers to directly assess the contribution of mitochondrial variants to phenotypic traits and investigate nuclear-mitochondrial interactions .

How do researchers address the challenges of working with hydrophobic membrane proteins like mt:CoII?

The hydrophobic nature of mt:CoII presents significant challenges for expression, purification, and functional analysis. Researchers employ several strategies to overcome these challenges:

  • Solubilization and stabilization strategies:

    • Use of specific detergents (DDM, LMNG, digitonin) to extract and maintain protein in solution

    • Nanodiscs and styrene maleic acid lipid particles (SMALPs) to maintain a lipid environment

    • Amphipols and fluorinated surfactants for enhanced stability

  • Fusion protein approaches:

    • Addition of solubility-enhancing tags (MBP, GST, SUMO)

    • Creation of chimeric proteins with soluble domains

    • Truncations to remove highly hydrophobic regions when feasible

  • Advanced purification techniques:

    • Two-phase extraction systems

    • Density gradient centrifugation

    • Size-exclusion chromatography with appropriate detergent micelles

  • Structural biology adaptations:

    • Crystallization in lipidic cubic phases

    • Cryo-EM approaches optimized for membrane proteins

    • NMR methods with specific isotopic labeling patterns

The most effective approach often involves a combination of these strategies, tailored to the specific experimental goals. For example, studies investigating COX activity commonly use a combination of detergent solubilization followed by Blue native PAGE to separate and characterize the intact complex, as demonstrated in studies of CG7630 knockdown effects on COX assembly in D. melanogaster .

What challenges exist in studying the interaction between nuclear-encoded and mitochondrial-encoded components of cytochrome c oxidase?

Investigating interactions between nuclear-encoded and mitochondrial-encoded components of COX involves addressing several complex challenges:

  • Asynchronous expression and assembly:

    • Nuclear and mitochondrial components are synthesized in different cellular compartments

    • Assembly occurs within the mitochondria through a coordinated process

  • Differential genetic manipulation:

    • Mitochondrial genes are more challenging to manipulate than nuclear genes

    • Limited tools for direct mitochondrial genome editing in Drosophila

  • Stoichiometry and dynamics:

    • Maintaining physiologically relevant ratios of components

    • Capturing transient interactions during assembly

  • Evolutionary divergence effects:

    • Cytonuclear incompatibilities between species or populations

    • Coevolutionary constraints on interacting surfaces

Methodological approaches to address these challenges include:

  • Cybrid models to control nuclear-mitochondrial combinations

  • In vitro reconstitution of COX from purified components

  • Proximity labeling approaches to identify interaction partners

  • Cross-linking mass spectrometry to map interaction surfaces

Studies have revealed evidence of cytonuclear coadaptation in COX across Drosophila species, with nuclear genes evolving to maintain compatibility with introgressed mitochondrial genomes, as observed in the D. yakuba-D. santomea hybrid zone . These findings highlight the importance of coordinated evolution between nuclear and mitochondrial components of the COX complex.

What does the evolutionary pattern of mt:CoII reveal about mitochondrial function across Drosophila species?

The evolutionary pattern of mt:CoII across Drosophila species reveals important insights about mitochondrial function and adaptation:

  • Functional constraints and conservation:

    • Catalytic sites and protein-protein interaction surfaces show high conservation

    • Transmembrane domains have intermediate conservation

    • Peripheral regions display higher evolutionary rates

  • Evidence of adaptive evolution:

    • Signatures of positive selection in specific lineages

    • Accelerated evolution in response to environmental changes

    • Coevolution with interacting nuclear-encoded subunits

  • Polymorphism patterns:

    • Greater variation in mtDNA genes compared to nuclear genes

    • Shared polymorphisms between closely related species

    • Lineage-specific mutations reflecting adaptation

Analysis of mt:CoII sequences across Drosophila species indicates that certain amino acid positions evolve under strong purifying selection due to their essential roles in COX activity. The glycine at position 177 in D. melanogaster COII, for example, is highly conserved across metazoans, and its mutation to serine results in reduced enzymatic activity . The evolutionary rate varies across different regions of the protein, with the highest conservation in functional domains involved in electron transfer and protein-protein interactions.

How do mt:CoII mutations affect organismal fitness across different Drosophila species?

The impact of mt:CoII mutations on organismal fitness varies across Drosophila species and demonstrates remarkable specificity in phenotypic effects:

Mutation TypeFitness EffectsTissue SpecificitySex Specificity
Catalytic site mutationsSevere reduction in viabilityGlobal, all tissues affectedBoth sexes equally affected
Interface mutationsModerate effects, often temperature-dependentTissue-specific effects commonMale-biased effects in some cases
Peripheral region mutationsMild or neutral effectsMinimal tissue-specific effectsLimited sex-specific effects

Studies of specific mt:CoII mutations provide detailed insights into these patterns. For example, the COII G177S mutation in D. melanogaster specifically impairs male fertility by affecting sperm development and function, without impairing other male or female functions, even at elevated temperatures . This male-specific effect aligns with the Mother's Curse hypothesis, which predicts the accumulation of mtDNA mutations that are harmful to males but neutral in females due to maternal inheritance of mitochondria.

The tissue and sex specificity of mt:CoII mutation effects can be explained by:

  • Differential energy requirements across tissues

  • Varying levels of compensatory mechanisms

  • Sex-specific selection pressures on mitochondrial function

  • Interactions with sex-specific nuclear genes

These findings highlight the complex relationship between mitochondrial mutations and organismal fitness, with implications for understanding mitochondrial disease and adaptation.

How does mt:CoII contribute to cytonuclear incompatibilities between Drosophila species?

Mt:CoII plays a significant role in cytonuclear incompatibilities between Drosophila species due to the coevolution of mitochondrial and nuclear genomes:

  • Mechanistic basis of incompatibilities:

    • Mismatches at protein-protein interfaces between mt:CoII and nuclear-encoded subunits

    • Disruption of assembly pathways due to recognition sequence divergence

    • Altered catalytic efficiency due to structural incompatibilities

  • Evolutionary dynamics:

    • Accelerated evolution of compensatory nuclear mutations following mitochondrial introgression

    • Lineage-specific coevolution creating species barriers

    • Differential selection pressures on mt:CoII across species

  • Genetic evidence:

    • Gene flow analyses in hybrid zones reveal patterns of mt:CoII introgression

    • Nuclear genes in OXPHOS pathway show signatures of selection following mitochondrial introgression

    • Experimental crosses demonstrate fitness consequences of mismatched genomes

A notable example comes from the D. yakuba-D. santomea hybrid zone, where the mitochondrial genome of D. yakuba introgressed into D. santomea and completely replaced its native form. Analysis of the 12 nuclear-encoded COX genes revealed significant gene flow from D. yakuba to D. santomea, suggesting cointrogression of nuclear genes along with the mitochondrial genome to maintain functional compatibility . This provides compelling evidence for cytonuclear coadaptation in the COX complex and illustrates how mt:CoII interactions with nuclear-encoded components can drive evolutionary processes.

What role does recombinant mt:CoII play in understanding the dual functions of cytochrome c in respiration and apoptosis?

Recombinant mt:CoII serves as a valuable tool for dissecting the complex relationship between the respiratory and apoptotic functions of cytochrome c in Drosophila:

  • Mechanistic investigations:

    • Structure-function studies to identify domains involved in cytochrome c binding

    • Interaction analyses between recombinant mt:CoII and cytochrome c variants

    • In vitro reconstitution of respiratory complexes with controlled components

  • Evolutionary insights:

    • Comparative analyses of mt:CoII-cytochrome c interactions across species

    • Correlation between mt:CoII sequence divergence and apoptotic pathway differences

    • Assessment of selection pressures on interacting domains

  • Functional assays:

    • Measurements of electron transfer efficiency with recombinant components

    • Testing cytochrome c release and caspase activation in response to mt:CoII variants

    • Evaluation of competition between respiratory and apoptotic functions

Drosophila presents a unique model for these studies due to its specialized cytochrome c system. Drosophila possesses two cytochrome c genes, cyt-c-d and cyt-c-p, with only cyt-c-d required for caspase activation in an apoptosis-like process during spermatid individualization . The relationship between these dual pathways and mt:CoII function provides insights into the evolution of these interconnected systems.

Research suggests that in Drosophila, the role of cytochrome c in apoptosis may be more limited than in mammals, with cytochrome c remaining associated with mitochondria during apoptosis in most Drosophila cells . By using recombinant mt:CoII to study interactions with cytochrome c variants, researchers can better understand how these systems have evolved and potentially identify novel regulatory mechanisms at the interface of respiration and apoptosis.

What are the most promising applications of recombinant Drosophila persimilis mt:CoII in future research?

Recombinant D. persimilis mt:CoII offers numerous promising applications for future research, spanning fundamental science to applied biotechnology:

  • Structural biology advancements:

    • Cryo-EM studies of intact COX complexes with variant mt:CoII subunits

    • Investigation of dynamic conformational changes during the catalytic cycle

    • Mapping of interaction networks within the respiratory complex

  • Evolutionary and comparative genomics:

    • High-resolution analysis of selection patterns across Drosophila species

    • Investigation of regulatory adaptations in mtDNA gene expression

    • Reconstruction of ancestral sequences to understand functional evolution

  • Biotechnological applications:

    • Development of biosensors for mitochondrial function

    • Design of screening platforms for mitochondrial disease therapeutics

    • Creation of model systems for testing mitochondrial gene therapies

  • Environmental adaptation studies:

    • Investigation of mt:CoII variants adapted to different thermal environments

    • Analysis of functional consequences of population-specific polymorphisms

    • Assessment of metabolic plasticity in response to environmental stressors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.