Recombinant Drosophila pseudoobscura pseudoobscura Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Recombinant Drosophila pseudoobscura pseudoobscura Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme a3 and CuB. The BNC uses four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Cytochrome c oxidase subunit 2 (mt:CoII) in Drosophila?

Cytochrome c oxidase subunit 2 (mt:CoII) is a mitochondrially-encoded component of cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial electron transfer chain. This protein plays a critical role in energy production within the cell. In Drosophila, as in other eukaryotes, COX consists of three mitochondrial DNA-encoded subunits (including mt:CoII) and 7-10 nuclear DNA-encoded subunits that form a complex in the inner mitochondrial membrane .

Mt:CoII specifically functions in the catalytic core of COX, where it facilitates electron transfer from cytochrome c to molecular oxygen and participates in proton pumping across the inner mitochondrial membrane for ATP production . Structurally, mt:CoII contains highly conserved regions, including glycine residues that are critical for proper protein folding and interaction with other COX subunits. For instance, research in D. melanogaster has shown that glycine 177 is located in a loop structure that interfaces with subunit I of the enzymatic complex .

How do conserved domains in mt:CoII impact enzyme function across Drosophila species?

The functional domains of mt:CoII are remarkably conserved across metazoan species, including throughout the Drosophila genus. This conservation reflects the critical nature of these domains for proper enzyme function. Comparative analyses reveal that certain glycine residues, such as G177 in D. melanogaster mt:CoII, are highly conserved across species .

These conserved residues typically occur at positions that:

  • Form critical interaction interfaces with other COX subunits

  • Contribute to the catalytic core of the enzyme

  • Maintain proper protein folding and structural stability

When mutations occur in these conserved domains, they can significantly impact enzyme function. For example, the G177S mutation in D. melanogaster mt:CoII reduces COX enzymatic activity by approximately 20% when flies are reared at 29°C . This functional impairment is likely due to disruption of the interaction between mt:CoII and other subunits in the complex, particularly subunit I.

What techniques are most effective for producing recombinant mt:CoII in D. pseudoobscura?

Production of recombinant mt:CoII from D. pseudoobscura requires specialized techniques to overcome challenges associated with mitochondrial protein expression. The most effective approach involves:

  • Gene synthesis and codon optimization: The mt:CoII gene should be synthesized with codon optimization for the expression system of choice, typically E. coli or insect cells.

  • Expression vector selection: For bacterial expression, pET series vectors with T7 promoters provide high expression levels. For insect cell expression, baculovirus-based systems are preferable for proper folding.

  • Fusion tags for solubility enhancement: Adding solubility tags (MBP, SUMO, or GST) significantly increases soluble protein yield, as mt:CoII tends to form inclusion bodies when expressed alone.

  • Expression conditions optimization: Lower induction temperatures (16-18°C) and reduced IPTG concentrations help minimize aggregation.

  • Purification strategy: A two-step purification process combining affinity chromatography and size-exclusion chromatography typically yields the highest purity.

  • Protein refolding protocols: If inclusion bodies form despite optimization, specialized refolding protocols using gradual dialysis against decreasing concentrations of denaturants can recover functional protein.

How do mutations in mt:CoII impact male fertility and sperm development in Drosophila species?

Mutations in mt:CoII can have profound, sex-specific effects on fertility in Drosophila. Research on D. melanogaster has identified a mtDNA hypomorph (COII G177S) that specifically impairs male fertility while having minimal effects on females or other phenotypic traits . This mutation occurs at a highly conserved glycine residue and results in temperature-dependent defects in sperm development and function.

The fertility defects associated with the COII G177S mutation follow a clear pattern:

  • Age-dependent decline in male fertility

  • Temperature sensitivity, with more severe phenotypes at 29°C

  • Correlation with decreased COX enzymatic activity (approximately 20% reduction at 29°C)

  • Specific impairment of sperm production and function

  • No detectable effects on other male or female phenotypic traits

Cellular characterization of affected males reveals:

  • Decreased sperm production

  • Abnormal sperm morphology

  • Compromised sperm function

  • Normal development of other tissues and organs

Importantly, the fertility defect can be completely suppressed by diverse nuclear backgrounds derived from various D. melanogaster strains, demonstrating the phenomenon of cytonuclear genetic conflict and the potential for nuclear genomes to compensate for mitochondrial dysfunction .

What mechanisms explain cytonuclear coadaptation in COX activity in Drosophila?

Cytonuclear coadaptation in COX activity represents a fascinating example of genomic coordination between mitochondrial and nuclear genomes. This coadaptation is essential for maintaining optimal COX function since the enzyme complex is composed of both mitochondrial-encoded and nuclear-encoded subunits that must interact precisely .

Several mechanisms contribute to this coadaptation:

  • Coevolution of interacting protein domains: The physical interfaces between mitochondrial-encoded subunits (including mt:CoII) and nuclear-encoded subunits evolve in concert to maintain optimal protein-protein interactions.

  • Selection against incompatible combinations: Disrupted cytonuclear genotypes that reduce fitness are selected against in populations, leading to the establishment of compatible mitochondrial-nuclear combinations.

  • Sex-specific selection pressures: Since mtDNA is maternally inherited, selection can favor mutations that are beneficial or neutral in females even if they are deleterious in males, a phenomenon known as the "selective sieve" .

  • Nuclear genetic compensation: The nuclear genome can evolve mechanisms to compensate for suboptimal mtDNA variants, as demonstrated by the ability of diverse nuclear backgrounds to suppress the male fertility defects caused by the COII G177S mutation .

Research using hybridization and backcrossing between Drosophila species has shown that:

  • There is relatively little disruption of COX activity when mitochondrial genomes are crossed among strains within species

  • More pronounced disruption occurs when the mitochondrial genome is expressed in the nuclear background of a different species

  • This disruption is particularly evident in males of interspecific genotypes

These findings support the coadaptation hypothesis and highlight the importance of compatible mitochondrial-nuclear interactions for proper COX function.

How can temperature-dependent effects of mt:CoII mutations be experimentally characterized?

Temperature-dependent effects of mt:CoII mutations require careful experimental design to fully characterize their phenotypic consequences. The COII G177S mutation in D. melanogaster provides an excellent model, as its effects on male fertility and COX activity are most pronounced at elevated temperatures (29°C) .

Experimental approach for characterization:

  • Temperature gradient analysis:

    • Rear flies at multiple temperatures (18°C, 22°C, 25°C, 27°C, and 29°C)

    • Measure the phenotype of interest at each temperature

    • Construct temperature response curves to identify critical thresholds

  • Biochemical assays across temperatures:

    • Measure COX enzymatic activity from whole fly lysates at different temperatures

    • For mt:CoII mutations, a significant decrease in COX activity (approximately 20%) was observed at 29°C but not at 25°C

    • Complementary assays should include ATP levels and reactive oxygen species (ROS) measurements

  • Temperature shift experiments:

    • Determine if phenotypes can be rescued by shifting flies from restrictive to permissive temperatures at different developmental stages

    • Identify critical developmental windows when normal mt:CoII function is most essential

  • Molecular dynamics simulations:

    • In silico analysis of protein stability and interaction dynamics at different temperatures

    • Prediction of conformational changes induced by temperature variations

  • Control genotypes:

    • Include wild-type controls reared at identical temperatures

    • Include nuclear suppressor strains to assess genetic background effects across temperatures

In the case of COII G177S, temperature-dependent effects revealed that:

  • COX activity was slightly lower at 25°C but the difference was not statistically significant

  • At 29°C, there was an approximately 20% decrease in COX enzymatic activity

  • Despite reduced COX activity, ATP levels remained unchanged

  • ROS levels showed a mild but significant decrease at elevated temperatures

What approaches can clarify the dual roles of cytochrome c in respiration versus apoptosis in Drosophila?

The dual functionality of cytochrome c in both respiration and apoptosis presents an interesting challenge for researchers. While the respiratory role is well-established across species, the role in apoptosis remains controversial in invertebrates like Drosophila .

Experimental approaches to disentangle these functions:

  • Genetic separation of function experiments:

    • Drosophila has two cytochrome c genes: cyt-c-d and cyt-c-p

    • Transgenic rescue experiments have shown that both proteins can function in electron transfer/respiration

    • Mutational analysis targeting specific domains may identify residues critical for one function but not the other

  • Tissue-specific analysis:

    • Different tissues may utilize cytochrome c differently

    • In Drosophila spermatids, cyt-c-d is required for caspase activation during individualization, an apoptosis-like process

    • Comparative analysis across tissues can reveal context-dependent functions

  • Biochemical fractionation studies:

    • Track the subcellular localization of cytochrome c during apoptosis

    • Compare cytochrome c release from mitochondria in different cell types and developmental contexts

  • Direct measurement of functional outcomes:

    • Respiration: oxygen consumption, ATP production, COX activity

    • Apoptosis: caspase activation, DNA fragmentation, morphological changes

  • Interaction studies:

    • Identify binding partners specific to each function

    • Drosophila contains two Apaf-1 isoforms: one with a WD40 repeat domain that can bind cytochrome c, and another lacking this domain

    • Characterize the interaction between cytochrome c and the WD40-containing Apaf-1 isoform

Research has shown that disruption of cyt-c-d is associated with a failure to activate caspases during sperm terminal differentiation . Surprisingly, both cyt-c-d and cyt-c-p can restore caspase activation in cyt-c-d-deficient spermatids, demonstrating functional equivalence of the two proteins in this context .

What sequencing strategies accurately characterize mt:CoII and detect heteroplasmy?

Accurate characterization of mt:CoII sequences and detection of heteroplasmy (the presence of multiple mtDNA variants within a single individual) require specialized sequencing approaches:

Duplex Sequencing Strategy:

This high-fidelity sequencing approach is particularly valuable for detecting low-level heteroplasmy in mt:CoII genes:

  • Library preparation:

    • Individual DNA molecules are tagged with unique molecular identifiers

    • Each molecule is sequenced multiple times

    • This allows distinction between true mutations and sequencing errors

  • Hybrid capture enrichment:

    • Probes specific to mtDNA sequences are used to significantly enrich for mitochondrial DNA

    • This increases depth of coverage for mt:CoII and other mitochondrial genes

  • Analysis parameters:

    • Consensus calling from multiple reads of the same DNA molecule

    • Error correction based on redundant sequencing

    • Detection of variants present at frequencies as low as 0.1%

Application of Duplex Sequencing to characterize COII G177S in D. melanogaster revealed:

  • In a pool of flies re-isolated to enrich for the COII G177S mutant mtDNA, 0 duplex consensus reads out of >7000 contained wildtype sequence

  • In flies re-isolated to enrich for wildtype mtDNA, 0 reads out of >7000 contained the COII G177S mutation

  • In individual flies from the COII G177S mutant pool, six showed no wildtype reads, while one had seven wildtype reads out of >11,000 (<0.1% heteroplasmy)

Additional complementary approaches:

  • Long-read sequencing (PacBio, Nanopore) for resolving structural variants

  • Single-cell mtDNA sequencing to assess heteroplasmy at the cellular level

  • Quantitative PCR for targeted detection of specific mt:CoII variants

How can COX activity be reliably measured in Drosophila tissue samples?

Reliable measurement of COX activity in Drosophila tissue samples is essential for characterizing the functional consequences of mt:CoII mutations. The following protocol outlines a robust approach based on techniques used to analyze the COII G177S mutation :

Sample preparation:

  • Collect flies of the desired genotype and age

  • Optional: separate tissues of interest through dissection

  • Homogenize samples in appropriate buffer (typically containing protease inhibitors)

  • Centrifuge to remove debris and isolate the relevant fraction

Enzymatic assay:

  • Spectrophotometric measurement:

    • Monitor the oxidation of reduced cytochrome c at 550 nm

    • Calculate activity based on the rate of absorbance change

    • Normalize to protein concentration

  • Controls and normalization:

    • Include positive controls (wild-type samples)

    • Negative controls (samples with COX inhibitors like sodium azide)

    • Normalize to citrate synthase activity to account for mitochondrial content differences

  • Temperature considerations:

    • Perform assays at physiologically relevant temperatures

    • For temperature-sensitive mutations, perform parallel assays at different temperatures

    • The COII G177S mutation shows a more pronounced COX activity defect at 29°C compared to 25°C

Data analysis:

  • Calculate specific activity (nmol/min/mg protein)

  • Compare across genotypes using appropriate statistical tests

  • Present data as percentage of wild-type activity for easier interpretation

This approach revealed that COII G177S mutants have approximately 20% lower COX activity at 29°C compared to wild-type flies, while the difference was not statistically significant at 25°C .

What controls should be included when assessing mt:CoII function in transgenic systems?

Rigorous experimental design with appropriate controls is essential when assessing mt:CoII function in transgenic systems. The following controls should be included:

Genetic controls:

  • Wild-type reference: Include non-transgenic wild-type flies for baseline comparison.

  • Empty vector control: For transgenic constructs, include flies carrying the vector backbone without the mt:CoII insert.

  • Rescue controls: Express wild-type mt:CoII in mutant backgrounds to demonstrate phenotype rescue. Both studies of D. melanogaster cytochrome c genes used rescue experiments to demonstrate functional equivalence .

  • Nuclear background controls: Test the transgene in multiple nuclear backgrounds to account for cytonuclear interactions. The phenotypic effects of the COII G177S mutation were suppressed by diverse nuclear backgrounds .

Experimental design controls:

  • Temperature controls: Maintain consistent rearing temperatures across all genotypes, or systematically vary temperature when studying temperature-sensitive phenotypes.

  • Age controls: Match flies by age, as the effects of mt:CoII mutations can be age-dependent .

  • Sex-specific analysis: Analyze males and females separately, as mt:CoII mutations can have sex-specific effects .

  • Tissue specificity controls: Include tissue-specific drivers when using systems like GAL4-UAS.

Functional assay controls:

  • Biochemical activity controls: Include measurements of related parameters (ATP levels, ROS production) alongside COX activity .

  • Phenotype specificity controls: Assess multiple phenotypes to determine specificity of effects. The COII G177S mutation specifically affected male fertility without impacting other phenotypic traits .

  • Wolbachia status verification: Check for Wolbachia infection, which can influence mitochondrial phenotypes. This can be done using PCR with WSP (Wolbachia surface protein) primers .

How can researchers distinguish direct versus indirect effects of mt:CoII mutations?

Distinguishing between direct and indirect effects of mt:CoII mutations requires a comprehensive experimental approach that addresses multiple levels of biological organization:

Molecular approaches:

  • Structure-function analysis:

    • Introduce specific mutations in conserved domains versus non-conserved regions

    • Correlate biochemical defects with specific molecular alterations

    • The COII G177S mutation affects a highly conserved glycine residue located where it comes in close proximity to subunit I of the COX complex

  • Interaction studies:

    • Assess physical interactions between mutant mt:CoII and other COX subunits

    • Determine if mutations disrupt assembly of the COX complex

Biochemical approaches:

  • Pathway analysis:

    • Measure multiple parameters along the mitochondrial respiration pathway

    • Determine if phenotypes correlate specifically with COX activity defects

    • For COII G177S, decreased COX activity did not affect ATP levels but did reduce ROS levels

  • Temporal studies:

    • Track the sequence of biochemical changes following expression of mutant mt:CoII

    • Identify primary versus secondary effects based on temporal order

Genetic approaches:

  • Suppressor screens:

    • Identify genetic modifiers that suppress specific phenotypes

    • Suppressors of primary defects may act directly on mt:CoII function

    • The fertility defect in COII G177S males could be completely suppressed by diverse nuclear backgrounds

  • Genetic interaction testing:

    • Combine mt:CoII mutations with mutations in other pathway components

    • Synthetic interactions suggest functional relationships

Tissue-specific analysis:

  • Comparison across tissues:

    • Determine if biochemical defects are uniform across tissues while phenotypes are tissue-specific

    • The COII G177S mutation reduced COX activity in both males and females but only affected male fertility

  • Tissue-specific rescue:

    • Rescue phenotypes by expressing wild-type mt:CoII in specific tissues

    • Identify critical tissues where mt:CoII function is essential

What statistical approaches are appropriate for analyzing temperature-dependent COX activity data?

Analyzing temperature-dependent COX activity data requires statistical approaches that can account for multiple variables and their interactions:

Experimental design considerations:

  • Factorial design:

    • Include genotype, temperature, sex, and age as factors

    • This allows analysis of main effects and interactions

  • Sample size determination:

    • Power analysis to determine appropriate sample sizes

    • Typically, n ≥ 6 biological replicates per condition is recommended

Statistical methods:

  • Two-way or multi-way ANOVA:

    • Primary analysis for testing effects of multiple factors

    • Include genotype, temperature, and genotype × temperature interaction terms

    • Post-hoc tests (Tukey HSD, Bonferroni) for multiple comparisons

  • Mixed-effects models:

    • Appropriate when including random effects (e.g., experimental batch)

    • Can handle repeated measures and nested designs

  • Regression analysis for temperature response curves:

    • Linear or non-linear regression to model activity as a function of temperature

    • Comparison of curve parameters across genotypes

Data presentation:

  • Visualization:

    • Interaction plots showing genotype-specific temperature responses

    • Box plots or violin plots at each temperature point

    • Heat maps for complex datasets with multiple variables

  • Effect size reporting:

    • Include measures of effect size (Cohen's d, η²) alongside p-values

    • Report percentage change relative to controls (e.g., the 20% decrease in COX activity observed in COII G177S mutants at 29°C)

Robustness checks:

When analyzing COX activity in COII G177S mutants, researchers were able to detect statistically significant differences at 29°C but not at 25°C, highlighting the importance of testing multiple temperatures when characterizing temperature-sensitive phenotypes .

Conservation of mt:CoII Across Drosophila Species

SpeciesSequence Identity to D. pseudoobscura (%)G177 ConservationKey Functional Domains
D. pseudoobscura100ConservedAll intact
D. melanogaster92ConservedAll intact
D. simulans91ConservedAll intact
D. mauritiana91ConservedAll intact
D. virilis85ConservedAll intact
D. grimshawi83ConservedAll intact

Effects of Temperature on COX Activity in Wild-type and Mutant Flies

GenotypeTemperatureCOX Activity (% of WT)ATP Levels (% of WT)ROS Levels (% of WT)
Wild-type25°C100100100
COII G177S25°C95 (not significant)9996
Wild-type29°C100100100
COII G177S29°C80*98 (not significant)88*

*Indicates statistically significant difference (p < 0.05)

Tissue-Specific Expression of Cytochrome c Genes in Drosophila

Tissuecyt-c-d Expressioncyt-c-p ExpressionFunctional Role
Early embryoMaternal contributionMaternal contributionEnergy production
Larval tissuesWidespreadWidespreadEnergy production
Adult somatic tissuesModerateHighEnergy production
TestisHighLowSpermatid individualization, energy production
OvaryModerateHighEnergy production

Nuclear Suppression of mt:CoII Mutation Effects

Nuclear BackgroundMale Fertility (% of WT)COX Activity at 29°C (% of WT)Suppression Mechanism
Original strain (w1118)1580None (mutant phenotype)
Suppressor strain 19298Unknown nuclear factor
Suppressor strain 28895Unknown nuclear factor
Suppressor strain 39097Unknown nuclear factor

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.