Recombinant Drosophila pseudoobscura pseudoobscura Nurim homolog (nrm)

Shipped with Ice Packs
In Stock

Description

Research Applications and Relevance

The recombinant nrm protein is primarily used in:

  • Structural Studies: Investigating nuclear envelope dynamics and chromatin interactions.

  • Evolutionary Genetics: Comparing chromatin landscapes between D. pseudoobscura and D. melanogaster, particularly in sex chromosome evolution .

  • Epigenetic Research: Exploring histone post-translational modifications (HPTMs) and chromatin state transitions during development .

Comparative Analysis with Other Species

The D. pseudoobscura genome exhibits extensive chromosomal rearrangements, including sex chromosome turnovers . Below is a comparison of nrm homologs across species:

SpeciesGene IDProtein LengthTag/ModificationHost SystemPurity
D. pseudoobscuraGA20505 (Q296J9)253 aaN-terminal HisE. coli>90%
D. melanogasterCG7655253 aaHis/Fc-Avi tagsE. coli, yeast, etc.>85%
Bos taurus (Bovine)RFL5378BFFull-lengthN-terminal HisE. coli>85%
Rhesus macaqueNRM-3102RFull-lengthHis-taggedE. coli>85%

Evolutionary Insights: D. pseudoobscura’s neo-sex chromosomes (XD/YD) show divergent chromatin states compared to D. melanogaster’s ancestral sex chromosomes, with reduced conservation in heterochromatic regions . While nrm itself is not directly implicated in these transitions, its homologs in other species highlight the importance of nuclear envelope proteins in genome organization.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag, please inform us; we will prioritize its development.
Synonyms
nrm; GA20505; Nurim homolog; Nuclear envelope membrane protein; Nuclear rim protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
nrm
Target Protein Sequence
MATFAKVMLLLSSVATFGYTFFVVGKLMLFLSTPRSISKAHTWIFNLLDNKSRLETAYGP IVFDTLYLIGFIFQHSFLKSALVKNLWRKLGLAAAERTIYSLTSSICLHYLLKNWLPAQS IVLWQVDVDESAPLWWTFVVTHGLGWAVIFGGSLIMDLPELLGVKQVYYDLKEYGEPVAY KSSELRNLYSHVRHPSFVGLSVILFATNVMSLDRLLLASLLTVYMYVAWSTDDKDVAYQK QQLRNKKHELKAQ
Uniprot No.

Target Background

Database Links
Protein Families
Nurim family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is the Nurim homolog (nrm) protein in Drosophila pseudoobscura?

Nurim homolog (nrm) in Drosophila pseudoobscura is a nuclear envelope membrane protein that functions as a nuclear rim protein. The full-length protein consists of 253 amino acids and is encoded by the nrm gene. According to UniProt database (ID: Q296J9), it is also known as GA20505, Nurim homolog, Nuclear envelope membrane protein, and Nuclear rim protein . This protein is part of the Drosophila pseudoobscura proteome, where D. pseudoobscura serves as an important model organism that was the second Drosophila species to have its genome sequenced in 2005 after Drosophila melanogaster .

How is recombinant D. pseudoobscura nrm protein typically produced for research?

Recombinant production of D. pseudoobscura nrm protein typically employs E. coli expression systems with His-tag fusion to facilitate purification. The process involves:

  • Expression System: The full-length protein (1-253aa) is expressed in E. coli with an N-terminal His tag .

  • Purification: Affinity chromatography using the His-tag for capture.

  • Final Form: The purified protein is typically provided as a lyophilized powder .

  • Storage Buffer: Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

  • Reconstitution Protocol:

    • Centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (typically to a final concentration of 50%) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

What is the purity standard for recombinant nrm protein in research applications?

For research applications, recombinant D. pseudoobscura nrm protein should meet a minimum purity standard of greater than 90% as determined by SDS-PAGE analysis . This high purity level ensures experimental reliability and reproducibility, particularly for structural studies, antibody production, and functional assays.

How do recombination rates affect genetic studies in D. pseudoobscura, including those involving nrm?

Recombination rates in D. pseudoobscura exhibit significant variation that researchers must consider when designing genetic studies involving genes like nrm:

  • Population Variation: Natural populations of D. pseudoobscura show significant differences in recombination rates. For example, individuals from Utah populations display approximately 8% higher crossover rates than Arizona populations, a difference that appears to be driven by natural selection rather than neutral processes .

  • Maternal Age Effects: Experimental evidence shows that maternal age significantly affects recombination rates in D. pseudoobscura. Studies observed a 3.39% increase in recombination rate due to maternal age (comparing 7-day-old females to 35-day-old females) during the first 72-hour period post-mating .

  • Genomic Variation: The recombination landscape variation is predominantly genome-wide rather than interval-specific at the 200-400kb scale .

  • Crossover Interference: Maternal age affects crossover interference, with decreased interference in progeny from older mothers in initial timepoints post-mating and increased interference in later timepoints .

These factors should be carefully considered when designing genetic mapping studies, knockout experiments, or analyzing linkage between nrm and other genes.

What methodological approaches are recommended for studying nrm protein function in D. pseudoobscura?

ApproachMethodologyApplication
Protein-Protein InteractionCo-immunoprecipitation using His-tagged nrmIdentify binding partners in nuclear envelope
Subcellular LocalizationImmunofluorescence with anti-His antibodiesConfirm nuclear rim localization
Functional AnalysisCRISPR/Cas9 gene editingGenerate knockout or point mutations
Structural StudiesReconstitution in membrane mimeticsDetermine membrane protein topology
Expression AnalysisqRT-PCR across developmental stagesProfile temporal expression patterns
Evolutionary AnalysisComparative genomics with D. melanogaster nrmIdentify conserved functional domains

For recombinant protein studies, it's critical to ensure proper protein folding, particularly given nrm's nature as a membrane protein. Using the provided reconstitution protocols with proper buffer conditions is essential for maintaining protein stability during experimentation .

How can researchers address challenges in working with recombinant nuclear membrane proteins like nrm?

Nuclear membrane proteins like nrm present specific experimental challenges. Recommended solutions include:

  • Storage Stability: Repeated freeze-thaw cycles significantly reduce protein activity. Store working aliquots at 4°C for up to one week, and maintain long-term stocks at -20°C/-80°C with 50% glycerol added as a cryoprotectant .

  • Reconstitution Methodology: Centrifuge lyophilized protein vials before opening to bring contents to the bottom. Reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol for long-term storage stability .

  • Alternative Expression Systems: For functional studies requiring post-translational modifications absent in E. coli, consider eukaryotic expression systems (insect cells, yeast) that may better preserve protein function.

  • Membrane Solubilization: Incorporate appropriate detergents or membrane mimetics during purification and storage to maintain native conformation of this integral membrane protein.

How does D. pseudoobscura's mating system influence genetic diversity studies?

D. pseudoobscura's polyandrous mating system has important implications for genetic diversity and experimental design:

  • Enhanced Genetic Diversity: Female D. pseudoobscura mate with multiple males, generating offspring with greater genetic diversity. This polyandry increases offspring viability and provides extinction protection against harmful genetic elements .

  • Sex Ratio (SR) Chromosome Effects: Some D. pseudoobscura males carry an SR chromosome that, when transmitted, produces only female offspring. Polyandry decreases SR gene frequency as non-SR male sperm outcompete SR sperm .

  • Experimental Implications: When designing genetic crosses for nrm studies, researchers should account for:

    • Higher genetic diversity in natural populations due to polyandry

    • Potential influence of SR chromosomes on sex ratios

    • Increased egg-to-adult survival in offspring from polyandrous females

These factors should inform experimental design, particularly for genetic mapping studies or when analyzing segregation of genetic markers linked to nrm.

How might supergene evolution in D. pseudoobscura affect research on nuclear envelope proteins?

Recent research on D. pseudoobscura has identified supergenes—large genomic regions containing multiple rearrangements where recombination is suppressed . These genomic features have significant implications for research on nuclear envelope proteins like nrm:

  • Recombination Suppression Impact: Supergenes evolve when recombination-suppressing mechanisms like inversions promote co-inheritance of alleles at multiple polymorphic loci . This could potentially affect the genetic linkage of nrm with nearby genes.

  • Evolutionary Trade-offs: The reduced recombination in supergene regions brings both benefits (maintaining co-adapted gene complexes) and costs (accumulation of deleterious mutations) .

  • Gene Flux Consideration: Rare "gene flux" between inverted and ancestral haplotypes can offset some costs of reduced recombination . This could potentially influence the evolution of nrm and its variability across populations.

  • Research Implications: When studying nrm in D. pseudoobscura, researchers should:

    • Determine whether nrm is located within or near known supergene regions

    • Consider potential linkage disequilibrium with nearby genes

    • Analyze population-specific variations that might affect nrm function

What comparative approaches can illuminate nrm function across Drosophila species?

Comparative studies can provide valuable insights into nrm function by leveraging evolutionary conservation:

  • Cross-species Comparison: Compare D. pseudoobscura nrm (1-253aa) with homologs in:

    • D. melanogaster (the primary Drosophila model)

    • Xenopus laevis (for which recombinant Nurim protein is also available)

  • Functional Domain Conservation: Identify conserved regions that likely represent functional domains critical for nuclear envelope structure or function.

  • Expression Pattern Analysis: Compare temporal and tissue-specific expression patterns of nrm across species to identify evolutionarily conserved regulatory mechanisms.

  • Methodological Approach:

    • Generate multiple sequence alignments of nrm homologs

    • Conduct phylogenetic analyses to trace evolutionary relationships

    • Perform synteny analysis to identify conservation of genomic context

    • Test for complementation by expressing D. pseudoobscura nrm in D. melanogaster nrm mutants

What is the recommended reconstitution protocol for lyophilized nrm protein?

For optimal reconstitution of lyophilized D. pseudoobscura nrm protein, follow this detailed protocol:

  • Pre-Reconstitution Preparation:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Equilibrate the lyophilized protein to room temperature

  • Reconstitution Steps:

    • Add deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

    • Gently mix by inversion or mild vortexing until completely dissolved

    • Avoid generating foam that could denature the protein

  • Long-term Storage Preparation:

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot into smaller volumes to prevent repeated freeze-thaw cycles

    • Flash-freeze aliquots in liquid nitrogen before transferring to -20°C/-80°C

  • Working Solution Handling:

    • Keep working aliquots at 4°C for no longer than one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

How should researchers account for population-specific recombination rate variation in D. pseudoobscura genetic studies?

When conducting genetic studies in D. pseudoobscura that involve recombination analysis or genetic mapping:

  • Population Origin Documentation: Always document and report the geographical origin of D. pseudoobscura stocks used in experiments, as recombination rates vary significantly between populations (e.g., 8% higher rates in Utah versus Arizona populations) .

  • Maternal Age Standardization: Standardize maternal age in genetic crossing experiments, as maternal age significantly affects recombination rates (3.39% increase in older females) .

  • Time-dependent Sampling: Be aware that recombination rate differences due to maternal age vary across time points post-mating. Design experiments to sample progeny at multiple defined intervals (e.g., 72-hour intervals up to 12 days post-mating) .

  • Statistical Power Considerations: Power analyses should account for the magnitude of recombination rate variation (typically 3-8% between treatments or populations) to ensure adequate sample sizes .

  • Crossover Interference Analysis: Include analysis of crossover interference, which can be affected by maternal age and varies temporally post-mating .

How might nrm protein function in the context of D. pseudoobscura speciation studies?

D. pseudoobscura is extensively used in laboratory studies of speciation, with evidence that allopatric speciation can be induced by reproductive isolation after only eight generations using different food types . Nuclear envelope proteins like nrm may play important roles in this process:

  • Reproductive Isolation Mechanisms: Nuclear envelope proteins can influence meiotic processes and chromosomal segregation, potentially contributing to hybrid incompatibility between emerging species.

  • Adaptive Evolution: The finding that recombination rate differences between populations appear to be under natural selection suggests that genes involved in nuclear envelope structure and function might similarly show adaptive divergence.

  • Research Approaches:

    • Compare nrm sequence and expression between emerging species

    • Analyze the role of nrm in meiotic processes during hybrid formation

    • Investigate whether nrm participates in genetic incompatibilities that contribute to reproductive isolation

What advanced methodologies are emerging for studying nuclear envelope dynamics in Drosophila?

Recent technological advances offer new opportunities for studying nuclear envelope proteins like nrm in D. pseudoobscura:

  • Live Imaging Techniques:

    • CRISPR-mediated tagging of endogenous nrm with fluorescent proteins

    • Super-resolution microscopy for nanoscale visualization of nuclear envelope structures

    • Light sheet microscopy for whole-organism developmental imaging

  • Functional Genomics Approaches:

    • Tissue-specific conditional knockdowns using the GAL4-UAS system

    • CRISPR interference (CRISPRi) for temporal control of gene expression

    • Single-cell RNA sequencing to identify cell type-specific expression patterns

  • Structural Biology Methods:

    • Cryo-electron microscopy for membrane protein structure determination

    • Cross-linking mass spectrometry for identifying protein-protein interactions

    • In-cell NMR for studying protein dynamics in near-native conditions

  • Evolutionary Genomics Integration:

    • Combine population genomics with functional studies to link genetic variation to phenotypic differences

    • Leverage natural variation in recombination rates to study nuclear envelope function in diverse genetic backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.