Recombinant Drosophila pseudoobscura pseudoobscura Opsin Rh2 (Rh2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rh2; GA14120; Opsin Rh2; Ocellar opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
Rh2
Target Protein Sequence
MERSLLPEPPLAMALLGPRFEAQTGGNRSVLDNVLPDMAPLVNPYWSRFAPMDPTMSKIL GLFTLVILIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYY ETWVLGPLWCDIYAACGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKIAFI WMMAVFWTIMPLIGWSSYVPEGNLTACSIDYMTRQWNPRSYLITYSLFVYYTPLFMICYS YWFIIATVAAHEKAMRDQAKKMNVKSLRSSEDCDKSAENKLAKVALTTISLWFMAWTPYL IICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRLVLKEKCPMCVCGSTD EPKPDAPPSDTETTSEAESKA
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Opsin Rh2 in Drosophila pseudoobscura?

Opsin Rh2 (also known as Ocellar opsin) is one of the photosensitive proteins in Drosophila pseudoobscura that functions as a visual pigment. It belongs to a family of G-protein coupled receptors that, when bound to a light-sensitive chromophore, detect photons and initiate the visual transduction cascade. In D. pseudoobscura, Rh2 is a full-length protein consisting of 381 amino acids that plays a crucial role in light perception, particularly in the ocelli (simple eyes) . Comparative studies have shown that while Rh2 performs fundamentally similar primary functions as other opsins, it exhibits distinctive evolutionary patterns and structural properties that make it valuable for evolutionary research .

How does Rh2 differ between D. pseudoobscura and D. melanogaster?

Comparative analyses reveal that Rh2 is one of the most divergent opsins between D. pseudoobscura and D. melanogaster, with approximately 90% amino acid identity, which is notably lower than other opsins like Rh1 and Rh4 that maintain over 95% identity between the species . This relatively rapid evolution is particularly evident at the DNA level, where Rh2 shows substantial variation at synonymous sites. While the Rh1 locus differs at only 26.1% of synonymous sites between these species, Rh2 and other opsin loci display differences at up to 39.2% of synonymous sites . These differences suggest that Rh2 has been subject to distinct selective pressures compared to other opsins, despite performing similar visual functions.

What factors influence the evolutionary rate of Rh2 in Drosophila species?

A particularly intriguing aspect is the decoupling between nucleotide substitution rates and amino acid replacement rates observed in opsins. For instance, Rh3 and Rh4 show similar levels of synonymous nucleotide substitution but significantly different rates of amino acid replacement . This suggests that different selective pressures act on these genes, despite their similar functions.

The chromosomal location of opsin genes also appears to influence their evolution. Research has documented rearrangements of chromosome elements containing opsin genes between D. pseudoobscura and D. melanogaster, which may contribute to variations in evolutionary rates . These genomic reorganizations potentially subject the genes to different regulatory environments and selective constraints.

What are the recommended methods for expression and purification of recombinant D. pseudoobscura Rh2?

For effective expression of recombinant D. pseudoobscura Rh2, E. coli expression systems have proven successful. The recommended approach involves:

  • Construct Design: Create an expression vector containing the full-length Rh2 sequence (amino acids 1-381) with an N-terminal His tag for purification purposes .

  • Expression Conditions: Transform the construct into an appropriate E. coli strain optimized for membrane protein expression (specific strains may include BL21(DE3), C41(DE3), or C43(DE3)).

  • Purification Protocol:

    • Harvest cells and lyse using appropriate buffers

    • Isolate the His-tagged protein using nickel affinity chromatography

    • Perform additional purification steps as needed (e.g., size exclusion chromatography)

    • Lyophilize the purified protein for long-term storage

  • Quality Control: Verify protein purity via SDS-PAGE, aiming for >90% purity .

What are the optimal storage conditions for recombinant Rh2 protein?

For optimal stability and functionality of recombinant D. pseudoobscura Rh2 protein, the following storage conditions are recommended:

Storage FormTemperatureBuffer CompositionSpecial Considerations
Long-term storage-20°C to -80°CTris/PBS-based buffer, pH 8.0, with 6% TrehaloseAliquoting is necessary to avoid freeze-thaw cycles
Working aliquots4°CSame as aboveStable for up to one week
Reconstituted proteinVariousDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol50% final glycerol concentration is recommended for freeze storage

It is critical to avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom.

How do synonymous and non-synonymous substitution patterns inform our understanding of Rh2 function?

The patterns of synonymous and non-synonymous substitutions in Rh2 provide critical insights into the functional constraints and adaptive evolution of this visual pigment. Comparative analyses between D. pseudoobscura and D. melanogaster reveal that while Rh2 has accumulated substantial synonymous site differences (up to 39.2%), the amino acid sequence remains relatively conserved with 90% identity .

This pattern suggests strong purifying selection on the protein's functional domains, indicating that despite rapid nucleotide evolution, the functional constraints on Rh2 remain significant. The selective pressure varies across different regions of the protein, with transmembrane domains typically showing higher conservation than loop regions.

Interestingly, the opsin genes show variable patterns of evolution that don't consistently correlate with base composition or codon usage bias . This suggests complex selective regimes that may be influenced by factors such as spectral tuning requirements, chromophore interaction efficiency, and signal transduction dynamics.

What techniques are most effective for studying Rh2 function in comparative vision research?

For comparative functional studies of Rh2 across Drosophila species, a multi-faceted approach is recommended:

  • Spectral Sensitivity Analysis: Heterologous expression of recombinant Rh2 in appropriate cell lines followed by reconstitution with 11-cis-retinal and microspectrophotometry to determine absorption maxima and spectral properties.

  • Electrophysiological Assays: Patch-clamp recordings or electroretinogram (ERG) measurements to assess the functional response properties of Rh2-expressing cells.

  • Molecular Evolution Analysis: Comparative sequence analysis focusing on sites known to influence spectral tuning in opsins can reveal adaptive changes .

  • Expression Profiling: Transcriptome analysis of retinal tissue to quantify expression levels and patterns across development and in different visual structures.

  • Structural Biology Approaches: X-ray crystallography or cryo-EM studies of purified recombinant Rh2 to determine protein structure and chromophore interaction sites.

  • CRISPR/Cas9 Gene Editing: Creating precise mutations in Rh2 to study the functional consequences of specific amino acid changes identified in evolutionary studies.

What are common challenges in working with recombinant Drosophila Rh2 and how can they be addressed?

Working with recombinant Opsin Rh2 presents several challenges that researchers should anticipate:

  • Protein Misfolding: As a membrane protein, Rh2 can be prone to misfolding during recombinant expression. This can be mitigated by:

    • Optimizing expression temperature (typically lower temperatures of 16-20°C)

    • Including specific detergents or lipids in the buffer system

    • Using specialized E. coli strains designed for membrane protein expression

  • Chromophore Binding Efficiency: Functional studies require proper binding of the chromophore to the opsin. Improve binding by:

    • Ensuring dark conditions during reconstitution

    • Optimizing pH and buffer conditions

    • Using freshly prepared 11-cis-retinal

  • Protein Aggregation: Prevent aggregation during storage and handling by:

    • Adding appropriate stabilizers such as trehalose (6%)

    • Maintaining optimal pH (approximately 8.0)

    • Proper aliquoting to avoid freeze-thaw cycles

How can researchers effectively compare evolutionary patterns of Rh2 with other opsin genes?

For robust comparative evolutionary analysis of Rh2 and other opsins, researchers should:

  • Implement Multiple Sequence Alignment: Use specialized alignment algorithms optimized for G-protein coupled receptors to ensure accurate alignment of transmembrane domains and functionally important regions.

  • Calculate Evolutionary Rates: Determine dN/dS ratios (non-synonymous to synonymous substitution rates) to identify patterns of selection across different opsin genes and protein domains .

  • Analyze Codon Usage Bias: Quantify codon usage patterns and correlate with gene expression levels and evolutionary rates .

  • Perform Synteny Analysis: Examine chromosomal arrangements and gene order conservation to identify potential rearrangements that might influence opsin evolution .

  • Conduct Phylogenetic Analysis: Construct gene trees to determine the relationship between different opsin paralogs and to identify potential gene conversion events.

  • Apply Tests for Selective Pressure: Use statistical tests such as McDonald-Kreitman test or PAML analysis to detect signatures of positive selection, purifying selection, or relaxed constraint.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.