Recombinant Drosophila pseudoobscura pseudoobscura Opsin Rh3 (Rh3)

Shipped with Ice Packs
In Stock

Description

Evolutionary Insights

Rh3 exhibits distinct evolutionary patterns compared to other Drosophila opsins:

Key Findings:

  • Synonymous vs. Replacement Substitutions: Rh3 and Rh4 share similar synonymous substitution rates (39.2% divergence between D. pseudoobscura and D. melanogaster) but differ in amino acid replacement rates, suggesting differential selective pressures .

  • Neutral Evolution: Analyses of Rh3 in the melanogaster subgroup indicate most amino acid replacements are neutral, driven by genetic drift rather than selection .

  • Promoter Structure: Rh3 and Rh4 share a bipartite promoter: a conserved "core" region and a distal regulatory element determining cell-specific expression in R7 photoreceptors .

Functional Role in Photoreception

Rh3 is specialized for UV light detection (absorption maxima ~331 nm) and is expressed in:

  • Inner R7 Photoreceptors: Paired with Rh4 in a complementary pattern .

  • Polarized Light Detection: Dorsal margin R7/R8 cells in the compound eye .

Comparative studies highlight its spectral tuning and interactions with downstream signaling cascades .

Research Applications

Recombinant Rh3 is primarily used for:

  • Structural Studies: Analyzing UV-sensitive opsin conformations via SDS-PAGE .

  • Evolutionary Genetics: Investigating codon bias, GC content, and selection pressures .

  • Phototransduction Pathways: Reconstituting signaling mechanisms in vitro .

Comparative Analysis with Other Opsins

OpsinSensitivityExpression CellsEvolutionary Rate (AA Identity)
Rh1Blue (486 nm)Outer photoreceptors95%
Rh3UV (331 nm)Inner R795%
Rh4UV (355 nm)Inner R7>95%
Rh7UnknownNon-retinal tissuesClosest to Rh3/Rh4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rh3; GA10619; Opsin Rh3; Inner R7 photoreceptor cells opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
Rh3
Target Protein Sequence
MEYHNVSSVLGNVSSVLRPDARLSAESRLLGWNVPPDELRHIPEHWLIYPEPPESMNYLL GTLYIFFTVISMIGNGLVMWVFSAAKSLRTPSNILVINLAFCDFMMMIKTPIFIYNSFHQ GYALGHLGCQIFGVIGSYTGIAAGATNAFIAYDRYNVITRPMEGKMTHGKAIAMIIFIYL YATPWVVACYTESWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYY SQIVGHVFSHEKALRDQAKKMNVDSLRSNVDKSKEAAEIRIAKAAITICFLFFASWTPYG VMSLIGAFGDKTLLTPGATMIPACTCKMVACIDPFVYAISHPRYRMELQKRCPWLAISEK APESAAAISTSTTQEQQQTTAA
Uniprot No.

Target Background

Function
Visual pigments, the light-sensitive molecules responsible for vision, consist of an opsin apoprotein covalently bound to cis-retinal.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the expression pattern of Rh3 differ between Drosophila species and what are its spectral characteristics?

Rh3 is primarily expressed in specific photoreceptor cells of the Drosophila retina, particularly in the R7p (pale) and R7marg (marginal) classes of photoreceptors . The spectral properties have been characterized using high-resolution microspectrophotometry:

OpsinλmaxExpression PatternSpecies Variation
Rh3345 nmR7p and R7marg photoreceptorsConserved across melanogaster subgroup
Rh4375 nmComplementary R7 cellsConserved across melanogaster subgroup

Transgenic expression studies have demonstrated that Rh3 is UV-sensitive, with maximum absorption at 345 nm, while the closely related Rh4 has a slightly longer wavelength sensitivity at 375 nm . Both function as UV-sensitive visual pigments but have distinct expression patterns in the retina, creating a mosaic of photoreceptor types that enhances visual discrimination in the UV spectrum.

What are the recommended storage and handling procedures for recombinant Rh3 protein to maintain structural integrity?

For optimal preservation of recombinant Drosophila pseudoobscura Opsin Rh3:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal)

  • Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Reconstituted protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Repeated freeze-thaw cycles significantly degrade protein quality and should be strictly avoided. The addition of glycerol as a cryoprotectant helps maintain the native conformation during freezing and thawing processes.

How has the Rh3 gene evolved within Drosophila species and what do molecular analyses reveal about its evolutionary history?

Molecular evolution studies of Rh3 reveal fascinating patterns of conservation and change across Drosophila species. DNA sequence analyses of five alleles from each of four species in the D. melanogaster subgroup, plus three alleles from D. pseudoobscura, show that:

Synonymous substitutions are unevenly distributed among structural domains of the Rh3 gene, with patterns of synonymous polymorphism correlating with GC content and codon bias .

How does the evolutionary rate of Rh3 compare to other opsin genes in Drosophila, and what factors influence these differential rates?

Comparative analyses reveal striking differences in evolutionary rates among Drosophila opsin genes:

Opsin GeneAmino Acid Identity between D. pseudoobscura and D. melanogasterSynonymous Site DifferencesEvolutionary Rate Characteristics
Rh1>95%26.1%Slowest evolutionary rate
Rh290%HighFastest protein evolution
Rh3~93%~39.2%High synonymous substitution
Rh4>95%~39.2%Conserved despite high synonymous rate

The most striking finding is the decoupling of nucleotide substitution and amino acid replacement rates. Rh3 and Rh4 show similar levels of synonymous nucleotide substitution but significantly different amounts of amino acid replacement, suggesting different selective pressures on these functionally similar genes .

There is significant heterogeneity in base composition and codon usage bias among the opsin genes in both species, but no consistent relationships between these factors and evolutionary rates have been established .

What phylogenetic relationships exist between Rh3 and other opsins, and what does this tell us about functional divergence?

Phylogenetic analyses of Drosophila opsin genes reveal two major clades:

  • Clade I:

    • Contains Rh3, Rh4, and Rh5

    • Resulted from tandem gene duplication that separated Rh5 from the closely related Rh3/Rh4

    • These predominantly function as short-wavelength (UV and blue) sensitive opsins

  • Clade II:

    • Contains Rh1, Rh2, and Rh6

    • Represents long-wavelength opsin gene duplications

    • Initial tandem duplication separated Rh6 from Rh1/Rh2

    • Further duplication led to separation of Rh1 and Rh2

Functional specialization followed these duplications:

  • Rh1 became expressed in outer photoreceptors of the compound eye

  • Rh2 became exclusively expressed in ocelli

  • Rh6 became expressed in inner photoreceptors of the compound eye

In lepidopterans, a comparable functional divergence has been observed. For example, Papilio Rh3 evolved from an ancestral green-sensitive (~520 nm) opsin to become red-sensitive (575 nm). This functional shift correlates with specific amino acid substitutions (positions 70, 94, 97) that also occurred independently in Heliconius lineages (550 nm) .

What expression systems are most effective for producing functional recombinant Rh3 protein?

Based on available research data, the following expression systems and methodologies are recommended:

  • E. coli Expression System:

    • Successfully used for producing full-length Drosophila pseudoobscura Opsin Rh3

    • Protein can be expressed with an N-terminal His-tag for purification

    • Yields protein suitable for structural and biochemical analyses

  • Transgenic Drosophila System:

    • More suitable for functional studies of Rh3

    • Allows expression in specific photoreceptor cells

    • Enables in vivo characterization of spectral properties

    • Can be used to express Rh3 in different photoreceptor classes to study functional properties

    • Permits coexpression with other opsins to analyze interaction effects

The choice of expression system depends on research objectives:

  • For structural studies: E. coli expression with appropriate purification

  • For functional studies: Transgenic Drosophila systems

  • For spectral characterization: In vivo expression followed by microspectrophotometry

What methods can be used to investigate the spectral tuning properties of Rh3, and how can specific amino acid contributions be determined?

To investigate spectral tuning of Rh3, researchers should consider these methodological approaches:

  • High-resolution microspectrophotometry:

    • Allows precise determination of wavelength sensitivity (λmax)

    • Has been successfully used to characterize Rh3's UV sensitivity (345 nm)

    • Can distinguish between closely related opsins (e.g., Rh3 at 345 nm vs. Rh4 at 375 nm)

  • Site-directed mutagenesis:

    • Identify potential spectral tuning sites through comparative analysis with related opsins

    • Target amino acids in the chromophore-binding pocket, particularly in transmembrane domains

    • Create point mutations at these sites and express in heterologous systems

    • Analyze spectral shifts caused by specific amino acid changes

  • Transgenic expression with sensitivity recordings:

    • Express modified Rh3 variants in photoreceptors

    • Perform electrophysiological recordings to measure spectral sensitivity

    • Compare wild-type and mutant responses across wavelengths

  • Structural modeling:

    • Map potentially important amino acids onto three-dimensional structures

    • Focus on residues facing the chromophore-binding pocket

    • Pay particular attention to transmembrane domain 3, which is known to influence spectral tuning

    • Look for substitutions involving hydroxyl-bearing amino acids (e.g., F to Y at position 94)

How can researchers effectively analyze promoter function and regulation of Rh3 expression in vivo?

For studying Rh3 regulation, researchers should implement these methodological approaches:

  • Promoter analysis via reporter constructs:

    • Identify minimal promoter regions controlling Rh3 expression

    • Create transgenic flies with Rh3 promoter regions driving reporter genes (e.g., GFP)

    • Analyze expression patterns in different photoreceptor types

    • Perform site-directed mutagenesis of potential regulatory elements

  • Transcription factor binding analysis:

    • Identify potential binding sites for transcription factors like Homothorax (Hth)

    • Create constructs with mutated binding sites

    • Compare expression patterns between wild-type and mutant promoters

    • Analyze the effects of transcription factor loss-of-function or overexpression

  • Transgenic rescue experiments:

    • Generate Rh3 null mutants

    • Introduce wild-type or modified Rh3 constructs to assess rescue of phenotypes

    • Compare spectral sensitivity and visual behavior between rescue lines

  • Isoform-specific antibody development:

    • Generate Rh3 isoform-specific antibodies

    • Map expression patterns in different photoreceptor types

    • Create detailed cell maps of Rh3 expression in the Drosophila retina

How should researchers interpret patterns of synonymous vs. non-synonymous substitutions in Rh3, and what do these patterns reveal about selection?

When analyzing synonymous and non-synonymous substitutions in Rh3:

What statistical approaches are most appropriate for testing evolutionary hypotheses about Rh3, and what are their limitations?

For robust evolutionary analysis of Rh3, researchers should consider:

  • McDonald-Kreitman test:

    • Compares the ratio of synonymous to non-synonymous substitutions within and between species

    • Useful for detecting adaptive evolution

    • Limitations: Not applicable to species comparisons approaching mutational saturation (e.g., D. pseudoobscura vs. D. melanogaster)

  • Hudson-Kreitman-Aguadé (HKA) test:

    • Tests for deviations from neutral expectations by comparing polymorphism within species to divergence between species

    • Can detect balancing selection or selective sweeps

    • Referenced as a complementary approach to McDonald-Kreitman in Rh3 studies

  • Tests of synonymous site distribution:

    • Analyze patterns of synonymous polymorphism with respect to GC content and codon bias

    • Can reveal selection on synonymous sites affecting translation efficiency

    • Particularly relevant for Rh3 where synonymous substitutions are unevenly distributed among structural domains

  • Phylogenetic methods for detecting positive selection:

    • Maximum likelihood tests for positive selection at specific codons

    • Identification of convergent or parallel amino acid substitutions correlated with functional shifts

    • Example: Detection of convergent substitutions at positions 70, 94, and 97 associated with spectral shifts in different lineages

How can researchers distinguish between neutral evolution and functional adaptation in Rh3, especially when analyzing spectral tuning changes?

To differentiate between neutral evolution and functional adaptation in Rh3:

  • Combine molecular evolutionary analysis with functional studies:

    • Identify sites with elevated dN/dS ratios

    • Test functional effects of mutations at these sites

    • Compare with naturally occurring variants in different species

  • Look for convergent evolution patterns:

    • Identify parallel amino acid substitutions in independent lineages

    • Determine if these changes correlate with similar functional shifts

    • Example: F to Y substitution at position 94 correlates with red-shifts in both Papilio and Heliconius lineages

  • Map substitutions onto protein structure:

    • Focus on substitutions in functionally relevant regions

    • Particularly examine residues facing the chromophore-binding pocket

    • Changes in transmembrane domains, especially involving hydroxyl-bearing residues, are likely to affect spectral tuning

  • Perform targeted mutagenesis experiments:

    • Introduce putative adaptive mutations into ancestral backgrounds

    • Test for predicted spectral shifts

    • Use heterologous expression systems or transgenic approaches for functional validation

  • Compare with known spectral tuning mechanisms:

    • Hydroxyl-bearing amino acid substitutions (e.g., F to Y) are known to cause spectral shifts in vertebrate opsins

    • Similar mechanisms may operate in insect opsins like Rh3

    • For example, the F to Y substitution at position 94 in the third transmembrane domain faces the chromophore-binding pocket and likely influences spectral properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.