Recombinant Drosophila pseudoobscura pseudoobscura Protein ST7 homolog (GA17575)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.

Synonyms
GA17575; Protein ST7 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
GA17575
Target Protein Sequence
MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING NDAQSDSSNGSGSSTSSGSSSSSNGGGGGGGGGAGGGGPGAGGGTNSTTTTGTQMPECKV WRNPLNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWR ERNPMQRIKSAHNALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQAT QHQGAIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHE NLIETLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLS PAEMSAVEAIHRAVEFNPHVPKYLLETKPLILPPEHILKRGDSEALAYAFFHLKHWKQVE GALNLLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFI LFTAGLCSFTALLALLTHQYPEPMGLLAQTVLTWISYPFQLLKERVEAFWPCNLLQQLSR V
Uniprot No.

Target Background

Database Links
Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Protein ST7 homolog (GA17575) and what are its basic characteristics?

Protein ST7 homolog (GA17575) is a protein expressed in Drosophila pseudoobscura pseudoobscura, a species of fruit fly. The protein has the UniProt accession number Q2M146 and is also referred to by its ORF name GA17575. The full-length protein consists of 541 amino acids with a complex sequence featuring multiple glycine-rich regions and transmembrane domains . The protein's structure includes characteristic folding patterns that place it within the larger family of membrane proteins, with distinctive transmembrane arrangements that contribute to its functional properties. When produced recombinantly, the protein typically achieves >85% purity as determined by SDS-PAGE analysis .

How should researchers store and handle recombinant GA17575 protein for optimal stability?

For proper handling of recombinant GA17575 protein, researchers should first centrifuge the vial briefly before opening to ensure the contents settle at the bottom. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For storage, the recombinant protein is typically provided in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . The reconstituted protein should be stored at -20°C for general use, or at -80°C for extended storage periods . To minimize protein degradation, repeated freeze-thaw cycles should be avoided. Working aliquots can be maintained at 4°C for up to one week to reduce freeze-thaw damage while maintaining protein integrity .

What expression systems are available for producing recombinant GA17575 protein, and how do they differ?

Recombinant GA17575 protein can be produced in multiple expression systems, each offering distinct advantages for different research applications:

Expression SystemProduct Code ExampleAdvantagesPotential Applications
E. coliCSB-EP639871DME1High yield, cost-effective, rapid productionStructural studies, antibody production
YeastCSB-YP639871DME1Post-translational modifications, proper foldingFunctional studies requiring eukaryotic processing
BaculovirusCSB-BP639871DME1Complex eukaryotic processing, high expressionProtein-protein interaction studies
Mammalian cellCSB-MP639871DME1Native-like modifications, proper foldingStudies requiring mammalian post-translational modifications

Additionally, biotinylated versions (e.g., CSB-EP639871DME1-B with Avi-tag Biotinylated) are available, where in vivo biotinylation is performed using E. coli biotin ligase (BirA), which specifically attaches biotin to the 15 amino acid AviTag peptide . This biotinylation enables applications requiring high-affinity streptavidin binding, such as protein immobilization and pull-down assays.

How can structural analysis be used to identify potential homologs of GA17575 across species?

Identifying homologs of proteins like GA17575 presents significant challenges due to extreme sequence divergence, with amino acid identity potentially as low as 8% across species. Rather than relying solely on primary sequence comparisons, researchers should employ tertiary structure-based screening approaches . This methodology recognizes that three-dimensional protein structure is generally more conserved than primary amino acid sequence. Computational tools like AlphaFold2, trRosetta, and RaptorX can generate structural predictions that can then be compared using quantitative tools like Dali .

When analyzing GA17575, researchers should focus on characteristic structural features such as: (i) the specific packing patterns of transmembrane domains, (ii) the projection of long transmembrane helices (particularly TM4, TM5, and TM6) that form the "anchor" domain where most inter-subunit contacts occur, and (iii) the distinctive splitting of TM7 into two subregions (TM7a and TM7b) . Quantitative structural comparison metrics provide more reliable indicators of homology than sequence identity scores alone, especially for highly divergent protein families.

What methodological approaches can be used to study GA17575 protein function in vivo?

For in vivo functional studies of GA17575, CRISPR-mediated gene tagging represents a powerful methodological approach. The CRIMIC (CRISPR-mediated integration cassette) strategy can be employed to integrate a Swappable Integration Cassette (SIC) containing elements like attP-FRT-Splice Acceptor (SA)-T2AGAL4-polyA-3XP3EGFP-polyA-FRT-attP (T2AGAL4) . This cassette typically creates a strong loss-of-function allele while simultaneously expressing the GAL4 transcription factor in a pattern that mimics the endogenous gene's expression.

The insertion methodology depends on whether GA17575 contains suitable coding introns. If suitable introns exist, an artificial exon can be inserted using homologous recombination with short homology arms (100-200 bp). If GA17575 lacks suitable introns (as is the case for approximately 58% of Drosophila genes), researchers should instead employ KozakGAL4 cassettes to replace the coding region, generating a knock-out/knock-in allele .

The resulting modified flies can be used to:

  • Determine the precise spatiotemporal expression pattern of GA17575

  • Study phenotypic consequences of GA17575 loss-of-function

  • Perform Recombinase Mediated Cassette Exchange (RMCE) to replace the insertion with fluorescent reporters for protein subcellular localization studies

What structural features distinguish GA17575 as a potential member of the 7TMIC family?

GA17575 exhibits structural characteristics consistent with membership in the 7-transmembrane ionotropic chemosensory receptor (7TMIC) family. When analyzing this protein, researchers should specifically examine the predicted structure for hallmark features including seven transmembrane domains with an intracellular N-terminus . Unlike classical GPCRs, these receptors form ligand-gated ion channels rather than coupling to G proteins.

For computational structural validation, researchers should:

  • Generate structural predictions using multiple algorithms (AlphaFold2, trRosetta, RaptorX) to increase confidence

  • Compare structural similarity to established 7TMIC members like Apocrypta bakeri Orco using quantitative metrics

  • Use negative controls (e.g., Rhodopsin, Frizzled, and Adiponectin receptors) to distinguish true structural similarity from convergent evolution

Of particular significance is the arrangement of TM4, TM5, and TM6, which in 7TMICs project below the main helix bundle to form the anchor domain critical for inter-subunit interactions. Additionally, the distinctive splitting of TM7 into TM7a (part of the anchor domain) and TM7b (lining the ion conduction pathway) provides further evidence of membership in this family .

How should researchers design experiments to study protein-protein interactions involving GA17575?

When investigating protein-protein interactions involving GA17575, researchers should employ a multi-method approach to ensure robust findings. For initial screening, yeast two-hybrid assays can identify potential interacting partners, but results should be validated using complementary techniques due to the high false-positive rate of this method.

For more precise interaction studies, researchers should:

  • Express recombinant GA17575 with appropriate tags (e.g., Avi-tag Biotinylated version) to facilitate pull-down assays

  • Implement co-immunoprecipitation experiments using antibodies specific to GA17575 or its putative binding partners

  • Employ in vitro binding assays with purified proteins to determine direct interactions and binding affinities

  • Validate interactions in vivo using techniques like proximity ligation assay (PLA) or bimolecular fluorescence complementation (BiFC)

For protein complexes, structural characterization using techniques like cryo-EM may be particularly valuable, especially given the recent success with other 7TMIC family members like Apocrypta bakeri Orco and Machilis hrabei MhOr5 . This approach would provide insights into how GA17575 interfaces with other proteins at the molecular level.

What are the optimal methods for analyzing GA17575 membrane topology and localization?

Determining the membrane topology and subcellular localization of GA17575 requires specialized experimental approaches due to its predicted multiple transmembrane domains. Researchers should implement the following methodological strategies:

  • Computational prediction analysis: Begin with in silico prediction of transmembrane domains using multiple algorithms (TMHMM, Phobius, MEMSAT) to establish a consensus topology model.

  • Epitope insertion scanning: Insert small epitope tags (e.g., FLAG, HA) at various positions throughout the protein sequence, followed by immunofluorescence under permeabilizing and non-permeabilizing conditions to map which regions are cytoplasmic versus extracellular.

  • CRISPR-mediated fluorescent tagging: Use the CRIMIC approach with fluorescent protein reporters to visualize the protein's localization in vivo . This can be achieved by:

    • Inserting artificial exons coding for fluorescent proteins in suitable introns

    • Replacing the coding region with KozakGAL4 followed by UAS-driven fluorescent reporters if GA17575 lacks suitable introns

  • Protease protection assays: Express the protein in microsomal preparations and treat with proteases to determine which regions are protected (luminal/extracellular) versus exposed (cytoplasmic).

For optimal results, researchers should combine multiple approaches and correlate findings with predicted structural models to develop a comprehensive understanding of GA17575's membrane topology and subcellular distribution.

How can researchers effectively perform structure-function analysis of GA17575?

Structure-function analysis of GA17575 requires a systematic approach combining computational prediction, targeted mutagenesis, and functional assays. Researchers should implement the following methodological framework:

  • Computational structural prediction: Generate high-confidence structural models using multiple algorithms (AlphaFold2, trRosetta, RaptorX) . Identify conserved structural motifs and potential functional domains by comparison with characterized 7TMIC family members.

  • Site-directed mutagenesis strategy: Design mutations targeting:

    • Conserved residues in TM7, which contains partially conserved motifs identified in insect Grs

    • The predicted ion conduction pathway lined by TM7b

    • Residues at the inter-subunit interface in the anchor domain formed by TM4, TM5, TM6, and TM7a

    • Potential ligand-binding sites identified through computational docking studies

  • Functional assays: Express wild-type and mutant proteins in appropriate systems (consider heterologous expression in Xenopus oocytes or HEK293 cells for electrophysiology). For in vivo analysis, generate CRISPR-mediated knock-in flies expressing mutant versions of the protein .

  • Phenotypic analysis: Use behavioral assays, electrophysiological recordings, and calcium imaging to assess how mutations affect protein function in both heterologous systems and in vivo.

By correlating functional changes with specific structural perturbations, researchers can develop a detailed map of structure-function relationships for GA17575, providing insights into its molecular mechanism and potential physiological roles.

How should researchers approach comparative analysis of GA17575 with other ST7 homologs?

Comparative analysis of GA17575 with other ST7 homologs presents unique challenges due to extreme sequence divergence. Researchers should implement a multi-layer analytical approach:

  • Sequence-based comparison: Beyond standard sequence alignment algorithms (which may fail with highly divergent sequences), implement profile-based methods like PSI-BLAST and HHpred that can detect remote homologies. Focus analysis on the TM7 region, which contains a partially conserved motif in insect Grs that may be present in GA17575 .

  • Structure-based comparison: Quantitatively compare predicted or experimentally determined structures using tools like Dali, TM-align, or FATCAT. This approach can reveal evolutionary relationships invisible at the sequence level . Specifically analyze:

    • RMSD of structural superpositions

    • Contact map similarities

    • Conservation of key structural motifs

  • Functional complementation: When possible, perform cross-species rescue experiments to test functional equivalence between GA17575 and putative homologs. This provides strong evidence for homology beyond sequence or structural similarity.

  • Phylogenetic analysis: Construct phylogenetic trees using structure-based alignments rather than sequence-based alignments for highly divergent proteins. Include established 7TMIC family members as reference points and use appropriate outgroups to root the tree.

This integrative approach enables researchers to place GA17575 accurately within the evolutionary context of ST7 homologs and the broader 7TMIC family, despite the challenges posed by sequence divergence.

What statistical approaches are most appropriate for analyzing GA17575 functional data?

When analyzing functional data related to GA17575, researchers should employ statistical methods appropriate for the specific experimental design and data characteristics:

  • For electrophysiological data:

    • Implement mixed-effects models to account for repeated measurements from the same cells/organisms

    • Use non-parametric tests when normality cannot be assumed

    • For dose-response relationships, fit data to appropriate models (Hill equation, logistic regression) and compare EC50/IC50 values with extra sum-of-squares F-test

  • For protein interaction studies:

    • Calculate binding affinities with appropriate error estimation

    • Implement bootstrapping approaches for robust confidence interval determination

    • Use multiple comparison corrections (e.g., Bonferroni, Benjamini-Hochberg) when screening multiple potential interactors

  • For in vivo phenotypic assays:

    • Implement power analysis before experiments to determine appropriate sample sizes

    • Consider hierarchical statistical approaches to account for genetic background effects

    • Use ANOVA with post-hoc tests for multi-group comparisons, ensuring assumptions are met

  • For structural prediction validation:

    • Compare multiple prediction algorithms using quantitative metrics

    • Implement statistical tests to determine if structural similarity scores exceed those expected by chance

    • Consider confidence metrics provided by prediction algorithms (e.g., pLDDT scores from AlphaFold2)

Researchers should prioritize effect size reporting alongside p-values and implement robust approaches to handle outliers without introducing bias. All statistical analyses should be performed with consideration of experimental design factors such as randomization, blinding, and appropriate controls.

How can CRISPR gene editing technologies be optimized for studying GA17575 function?

CRISPR-based approaches offer powerful tools for studying GA17575 function, but require optimization for maximum efficiency. Researchers should implement the following methodological strategies:

  • Donor construct optimization: Use synthesized homology arms (100-200 bp) to facilitate integration of artificial exons or replacement cassettes. For improved efficiency, incorporate the donor construct into custom vector backbones containing the target gene sgRNA, which eliminates the need for a separate sgRNA plasmid and significantly increases transgenesis efficiency .

  • Strategic targeting based on gene structure: Analyze the exon-intron structure of GA17575 to determine the optimal approach:

    • If suitable coding introns are present, insert T2AGAL4 cassettes via homologous recombination

    • If suitable introns are absent, replace the coding region with KozakGAL4 cassettes

  • Validation strategies: Implement comprehensive validation of edited alleles:

    • PCR-based genotyping to confirm integration at the correct locus

    • Sequencing to verify the absence of mutations at integration junctions

    • RT-PCR to confirm appropriate transcription of modified alleles

    • Western blotting to verify translation effects (protein truncation or elimination)

  • Functional rescue: Develop complementation constructs expressing wild-type GA17575 to verify phenotypes are specifically due to GA17575 disruption rather than off-target effects.

The optimized CRISPR approach enables targeting nearly every fly gene, regardless of exon-intron structure, with a reported 70-80% success rate , making it highly applicable for GA17575 functional studies.

What integrative approaches can reveal the biological role of GA17575 in Drosophila pseudoobscura pseudoobscura?

Understanding the biological function of GA17575 requires an integrative research approach combining multiple methodologies:

  • Expression pattern analysis: Use CRISPR-mediated T2AGAL4 or KozakGAL4 integration to drive UAS-reporter expression, revealing the spatiotemporal expression pattern of GA17575 . Compare expression patterns across developmental stages and in response to environmental stimuli.

  • Interactome mapping: Identify protein interaction partners through proteomics approaches (AP-MS, BioID), followed by functional validation. Construct an interaction network and analyze it for enriched biological processes.

  • Comparative genomics: Examine the conservation and divergence of GA17575 across Drosophila species, particularly focusing on:

    • Sequence evolution rates in different protein domains

    • Presence/absence patterns across species

    • Correlation with ecological or behavioral traits

  • Phenotypic characterization: Analyze GA17575 mutant phenotypes across multiple levels:

    • Molecular: Transcriptome and proteome alterations

    • Cellular: Effects on cell morphology, signaling pathways, and physiology

    • Organismal: Development, behavior, physiology, and fitness

  • Environmental response: Characterize how GA17575 function responds to environmental variables, especially if it belongs to the chemosensory receptor family, by examining:

    • Ligand binding profiles

    • Activity under different temperature, pH, or osmotic conditions

    • Regulation in response to physiological states

By integrating data across these approaches, researchers can develop comprehensive models of GA17575's biological function within the broader context of Drosophila biology.

What are the key considerations for designing experiments to characterize novel functions of GA17575?

When designing experiments to uncover novel functions of GA17575, researchers should implement a systematic discovery-driven approach that integrates multiple methodologies:

  • Hypothesis generation through computational analysis: Use comparative genomics, protein structure prediction, and evolutionary analysis to generate testable hypotheses about potential functions. Pay particular attention to structural features that suggest membership in the 7TMIC family, which would indicate potential roles in chemosensation .

  • Phenotypic screening strategy: Develop a tiered phenotyping approach:

    • Primary screen: Use CRISPR-mediated gene disruption to assess gross phenotypic effects

    • Secondary screen: Implement targeted assays based on primary findings and predicted protein function

    • Tertiary screen: Perform detailed mechanistic investigations of the pathways involved

  • Context-dependent function analysis: Examine GA17575 function across:

    • Different developmental stages

    • Various tissues where expression is detected

    • Different physiological states

    • Multiple environmental conditions

  • Interaction network perturbation: Manipulate putative interaction partners identified through proteomics to determine functional relationships and pathway positioning.

  • Cross-species complementation: Test whether GA17575 homologs from other species can rescue mutant phenotypes to assess functional conservation versus divergence.

By implementing this systematic approach, researchers can overcome the challenges of studying proteins with limited prior functional characterization, potentially revealing novel biological roles for GA17575 beyond current predictions based on structural homology.

How should researchers integrate findings about GA17575 into broader understanding of protein evolution and function?

Integrating GA17575 research findings into the broader context of protein evolution and function requires careful analysis and interpretation:

  • Evolutionary context placement: Position GA17575 within the evolutionary history of the 7TMIC family by:

    • Constructing phylogenetic trees based on structural rather than sequence similarities

    • Mapping functional domains and their conservation patterns across species

    • Identifying potential gene duplication and divergence events

  • Structure-function relationship mapping: Correlate structural features with functional properties to identify:

    • Conserved functional motifs that may indicate ancestral functions

    • Lineage-specific structural adaptations that may reflect specialized functions

    • Structural convergence versus homology with other protein families

  • Integration with systems biology data: Connect GA17575 function to larger biological processes by:

    • Mapping its role within signaling networks

    • Identifying regulatory relationships with other genes

    • Connecting molecular function to cellular and organismal phenotypes

  • Translational implications: Consider how findings about this Drosophila protein might inform understanding of related proteins in other species, including potential human homologs identified through structural screening approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.