Recombinant Drosophila pseudoobscura pseudoobscura Putative inositol monophosphatase 3 (GA13929)

Shipped with Ice Packs
In Stock

Description

General Information

The compound "Recombinant Drosophila pseudoobscura pseudoobscura Putative inositol monophosphatase 3 (GA13929)" refers to a protein within the inositol monophosphatase family, specifically found in Drosophila pseudoobscura pseudoobscura . Inositol monophosphatases are enzymes involved in various crucial cellular processes, including signal transduction, energy metabolism, and stress response within the endoplasmic reticulum .

Function and Importance

Inositol monophosphatases, such as the one encoded by the IMPAD1 gene in humans, catalyze the hydrolysis of phosphoadenosine phosphate (PAP) into adenosine monophosphate (AMP) . Myo-inositol, a precursor of phosphatidylinositol (PI), plays essential roles in signal transduction, energy metabolism, endoplasmic reticulum stress response, and osmoregulation . Organisms can acquire inositol through:

  1. Transport from the extracellular environment.

  2. Recycling of inositol phosphates.

  3. Synthesis from glucose-6-phosphate .

The enzyme myo-inositol-3-phosphate synthase (MIPSp) catalyzes the rate-limiting step in inositol synthesis .

Drosophila melanogaster as a Model Organism

Drosophila melanogaster serves as a model organism to study inositol metabolism and its role in spermatogenesis . The Inos gene in Drosophila melanogaster encodes MIPSp, and its expression is notable during early embryogenesis and larval stages . Studies using Drosophila melanogaster have demonstrated that dietary or endogenously synthesized inositol can reduce obesity-like symptoms and high hemolymph glucose levels in larvae .

Regulation of Inos mRNA

Research indicates that Inos mRNA levels are regulated by dietary inositol . Higher sucrose diets can also influence Inos mRNA levels. Dysregulation of Inos mRNA can lead to developmental defects and pupal lethality in Drosophila melanogaster .

5.1. Regulation of Inos mRNA by Inositol

Quantitative real-time PCR (qRT-PCR) experiments on Drosophila melanogaster larvae revealed that Inos mRNA levels are lower in larvae grown on a high-sucrose diet (0.75 M) compared to a low-sucrose diet (0.15 M). Supplementation with 50 µM inositol further reduced Inos mRNA levels in both dietary conditions (Fig. 1) .

5.2. Impact on Obese-like Phenotypes and Glucose Levels

Wild-type Drosophila melanogaster larvae grown on a high-sucrose diet exhibited obese-like characteristics, with elevated triglyceride (TAG) and hemolymph glucose levels. Inositol supplementation reduced the proportion of obese-like larvae and TAG levels under both low- and high-sucrose conditions. Additionally, inositol supplementation decreased hemolymph glucose concentration in larvae on both diets (Fig. 2) .

5.3. Effects of Upregulated Inos mRNA

Experiments with upregulated Inos mRNA showed that control wild-type larvae had lower Inos mRNA levels when the standard diet was supplemented with 50 µM inositol. Strains with dysregulated high levels of Inos mRNA and MIPSp displayed fewer obese-like larvae, decreased TAG levels, and lower hemolymph glucose levels (Fig. 4) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation during production.
Synonyms
GA13929; Putative inositol monophosphatase 3; IMP 3; IMPase 3; Inositol-1(or 4-monophosphatase 3; Myo-inositol monophosphatase A3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
GA13929
Target Protein Sequence
MSSSKMNGRSIRINRVPATIFAILLTIVLVYFLNFHQEERPAIYGKLRSDNPNRVNLRKM LIAAIQASQRGGLEVLDVARSRQLKVRSKGQTDEGVNDPFTDADGRSHCVMKQGLQRIFP RVRIFSEEDKEHCKESHSYDLDPTVLHETAQVPDVSVNAQDVTVWVDPLDATKEFTEELY EYVTTMVCVAVAGRPVIGVIHSPFNGQTAWAWVGNSMSEYLAGLHPPHGQENELPIITVS RSHTAGAKDLARGIFGEQVNLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL HALGGTMTTLNDQLIRYGPDESPVNTEGLLATLEKHDKYMDQLVKYRTAHNGQLA
Uniprot No.

Target Background

Database Links
Protein Families
Inositol monophosphatase superfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does the structure of GA13929 compare to other known inositol monophosphatases?

While the specific tertiary structure of GA13929 has not been fully characterized in the provided literature, related studies on Drosophila melanogaster INOS (myo-inositol-1-phosphate synthase) reveal that these enzymes typically form higher-order structures. For instance, the native D. melanogaster INOS has a molecular weight of approximately 271,000 ± 15,000 Da, while a single subunit is approximately 62,000 ± 5,000 Da as detected by SDS-PAGE, suggesting oligomerization .

What are the documented enzymatic activities of GA13929 and optimal conditions for its activity?

While the specific enzymatic properties of GA13929 from D. pseudoobscura have not been fully characterized in the provided literature, insights can be drawn from studies on related inositol-processing enzymes:

  • Substrate specificity: Inositol monophosphatases typically hydrolyze myo-inositol phosphates, particularly D-myo-inositol-1-phosphate.

  • Optimal conditions: Based on studies of related enzymes like D. melanogaster INOS, optimal activity might be expected around pH 7.5 and temperature of 40°C .

  • Cofactor requirements: While INOS requires NAD+ for the conversion of glucose-6-phosphate to inositol-1-phosphate , inositol monophosphatases like GA13929 typically require divalent metal ions (often Mg²⁺) but not NAD+ for their phosphatase activity.

For precise enzymatic characterization of GA13929, researchers should conduct specific activity assays using purified recombinant protein against various substrates.

How does GA13929 substrate specificity compare with other inositol monophosphatases?

Inositol monophosphatases show varying degrees of substrate specificity. While specific data for GA13929 is limited in the provided search results, comparative data for other inositol monophosphatases provides valuable insights:

SubstrateIMPL1 (Rate %)IMP (Rate %)
D-myo-Inositol 1-phosphate100100
D-Galactose 1-phosphate105.416.6
β-Glycerophosphate (glycerol 2-P)39.752
D-myo-Inositol 3-phosphate18.8100
D-myo-Inositol 2-phosphate17.80.94
L-Galactose 1-phosphate7.6166–240
Adenosine 2′-phosphate3.69.6
α-D-Glucose 1-phosphate2.819.3
D-α-Glycerophosphate (glycerol 3-P)0.244.9
α-D-Glucose 6-phosphate00.25
D-Mannitol 1-phosphate010.5

This substrate comparison table demonstrates that even within the inositol monophosphatase family, enzymes exhibit distinct substrate preferences . For example, IMPL1 hydrolyzes D-Galactose 1-phosphate as effectively as D-myo-Inositol 1-phosphate, similar to human IMP. This suggests that researchers should test GA13929 against multiple substrates to fully characterize its specificity profile rather than assuming it only processes inositol phosphates.

What is the recommended protocol for reconstitution and storage of recombinant GA13929 protein?

For optimal handling of recombinant GA13929:

  • Reconstitution:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Store reconstituted aliquots at -20°C/-80°C for long-term storage

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they may compromise protein activity

  • Buffer information:

    • The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

This careful handling ensures maximum retention of enzymatic activity for experimental applications.

What are the recommended methods for assaying GA13929 enzymatic activity?

For accurate assessment of GA13929 activity, researchers should consider these methodological approaches:

  • Spectrophotometric assays: Measure the release of inorganic phosphate from inositol phosphate substrates using colorimetric methods such as malachite green or molybdate-based assays.

  • Substrate selection: Begin with D-myo-inositol-1-phosphate as the primary substrate, but also test other substrates including D-myo-inositol-3-phosphate, D-galactose-1-phosphate, and β-glycerophosphate based on the known activities of related enzymes .

  • Reaction conditions:

    • Buffer: Typically Tris-HCl at pH 7.5

    • Temperature: Around 37-40°C (based on optimal temperature for related enzymes)

    • Divalent cations: Include Mg²⁺ (typically 1-5 mM)

    • Reaction time: 15-30 minutes is often sufficient

  • Controls:

    • Include enzyme-free reactions as negative controls

    • Use commercially available inositol monophosphatase as a positive control

    • Run substrate-free reactions to account for background phosphate

  • Inhibition studies: Use lithium (Li⁺) as a specific inhibitor of inositol monophosphatases to confirm the specificity of the observed activity.

These methodological considerations will help ensure reliable and reproducible activity measurements.

How does inositol monophosphatase activity influence metabolic phenotypes in Drosophila models?

Inositol monophosphatases play critical roles in Drosophila metabolism, with direct implications for metabolic disorders:

  • Obesity regulation: Studies in Drosophila melanogaster show that inositol metabolism affects obesity phenotypes. Dietary inositol reduces obesity-like phenotypes in larvae fed high-sucrose diets. Upregulation of inositol synthesis dramatically reduced the percentage of "obese" larvae from 74.75±1.94% to 13.28±4.42% in experimental models .

  • Glucose homeostasis: Inositol supplementation or increased endogenous synthesis reduces high hemolymph glucose levels in Drosophila larvae, suggesting a role in glucose metabolism regulation .

  • Transcriptional feedback: Inos mRNA levels (encoding myo-inositol-3-phosphate synthase) are regulated in response to dietary inositol availability - when more inositol is provided, less Inos mRNA is produced, demonstrating a feedback mechanism .

  • Developmental impacts: Dysregulation of inositol synthesis results in developmental defects and pupal lethality. The few individuals that survive to adulthood show structural alterations in wings and legs, and heads lacking proboscises, indicating the crucial role of regulated inositol metabolism in development .

These findings suggest that inositol monophosphatases like GA13929 could be important regulators at the intersection of metabolism and development, making them valuable targets for studying metabolic disorders.

What are the implications of inositol monophosphatase activity for signaling pathways relevant to disease models?

Inositol monophosphatases participate in several signaling pathways with disease relevance:

  • Phosphatidylinositol signaling: By regulating inositol availability, these enzymes influence the synthesis of phosphatidylinositol (PI) and its derivatives, which are critical second messengers in multiple signaling cascades .

  • Akt signaling pathway: Research shows that inositol monophosphatase 1 (IMPA1) forms a complex with the Receptor for Advanced Glycation End products (RAGE), which correlates with accumulation of phosphatidylinositol (3,4,5)-trisphosphate (PIP₃), membrane translocation of PI3K, and increased membrane Akt levels and phosphorylation .

  • Metabolic disease connections: Abnormalities in myo-inositol metabolism have been implicated in type 2 diabetes, cancer, neurodegenerative disorders, and other conditions .

  • Glycolytic shift mechanism: In pulmonary arterial hypertension (PAH), increased glucose uptake and metabolism (glycolytic shift) could potentiate IMPA1 activity due to elevated G6P levels. This would increase myo-inositol production and stimulate inositol-dependent pathways, including Akt activation .

Understanding GA13929's specific role in these pathways could provide insights into metabolic disorders and potential therapeutic approaches.

How does GA13929 from Drosophila pseudoobscura compare to homologs in other Drosophila species?

While comprehensive comparative data specifically for GA13929 is limited in the provided search results, several insights can be drawn:

  • Evolutionary conservation: Inositol monophosphatases are generally well-conserved across species, suggesting functional importance. The presence of homologous proteins in both D. pseudoobscura and D. melanogaster indicates conservation within the Drosophila genus.

  • D. melanogaster homolog: The D. melanogaster INOS (encoding MIPSp) has been more extensively characterized, with a documented role in converting glucose-6-phosphate to inositol-1-phosphate .

  • Expression patterns: In D. melanogaster, Inos mRNA shows specific temporal expression patterns, with peaks during early embryogenesis, larval stages, and high expression in adult head and testes .

  • Functional similarities: Both D. pseudoobscura GA13929 and its D. melanogaster counterparts are involved in inositol metabolism, which affects metabolic homeostasis and development in these model organisms.

For a complete comparative analysis, researchers should consider conducting sequence alignment studies, expression profiling across tissues and developmental stages, and functional complementation assays.

What is known about the evolution and conservation of inositol monophosphatase enzymes across different taxonomic groups?

Inositol monophosphatases show interesting evolutionary patterns:

  • Substrate specificity evolution: The inositol monophosphatase family shows diverse substrate specificities. For example, while some family members like IMPL1 can hydrolyze both D-myo-inositol 1-phosphate and D-galactose 1-phosphate with similar efficiency, others like IMPL2 have evolved to function as histidinol-phosphate phosphatases involved in amino acid synthesis .

  • Conservation across kingdoms: Inositol monophosphatases are found across bacteria, plants, and animals, indicating ancient evolutionary origins and fundamental cellular importance.

  • Structural conservation: Despite functional diversification, the core catalytic domain structure is generally conserved, typically requiring divalent metal ions for activity.

  • Functional adaptation: The varying substrate specificities observed across family members (as shown in the substrate comparison table) suggest evolutionary adaptation to different metabolic needs across species .

Understanding GA13929's position within this evolutionary context could provide insights into its specific functional role in D. pseudoobscura and how this might differ from related enzymes in other species.

How can GA13929 be utilized as a tool for studying inositol-dependent signaling pathways in metabolic disorders?

GA13929 offers several research applications for investigating metabolic disorders:

  • Overexpression systems: Creating transgenic Drosophila lines with controlled GA13929 expression can help elucidate the impact of altered inositol metabolism on obesity and diabetes-like phenotypes. This approach has shown promising results with related proteins, where upregulation of inositol synthesis reduced obesity and hyperglycemia in high-sucrose diet models .

  • Structure-function analysis: Site-directed mutagenesis of GA13929 can identify critical residues for substrate binding and catalysis, providing insights into how genetic variations might affect enzyme function in metabolic disorders.

  • Inhibitor screening: The recombinant protein can serve as a target for screening small molecule libraries to identify specific inhibitors, which could have therapeutic potential for conditions involving dysregulated inositol metabolism.

  • Interaction studies: Investigating GA13929's protein-protein interactions, similar to the IMPA1-RAGE interaction , could reveal its role in signaling networks relevant to metabolic diseases.

  • Metabolic flux analysis: By manipulating GA13929 activity and tracking changes in inositol-derived metabolites, researchers can gain insights into how inositol metabolism influences broader metabolic networks.

These approaches can contribute to understanding the molecular basis of metabolic disorders and potentially identify new therapeutic targets.

What are the current technical challenges and limitations in studying GA13929 function, and how might they be addressed?

Researchers face several challenges when investigating GA13929:

  • Protein stability issues:

    • Challenge: Recombinant inositol monophosphatases may show reduced stability after purification.

    • Solution: Optimize buffer conditions with stabilizing agents like trehalose (as used in commercial preparations ), and maintain strict temperature control during purification and storage.

  • Substrate availability and specificity:

    • Challenge: Limited commercial availability of diverse inositol phosphate substrates hinders comprehensive specificity testing.

    • Solution: Develop enzymatic or chemical synthesis methods for preparing various inositol phosphate isomers, or establish collaborations with specialized chemical biology groups.

  • In vivo functional validation:

    • Challenge: Determining the physiological role of GA13929 specifically versus other inositol-metabolizing enzymes.

    • Solution: Develop CRISPR/Cas9 gene editing protocols for D. pseudoobscura to create precise knockouts or mutations, combined with metabolomic profiling to identify shifts in the inositol metabolic landscape.

  • Tissue-specific expression patterns:

    • Challenge: Understanding where and when GA13929 is expressed in D. pseudoobscura.

    • Solution: Generate tissue-specific transcriptome data and develop antibodies for immunohistochemistry to map expression patterns across development and tissues.

  • Translating findings between species:

    • Challenge: Extrapolating findings from D. pseudoobscura to other model organisms or humans.

    • Solution: Perform comparative functional studies using orthologous proteins from multiple species, including human inositol monophosphatases, to identify conserved and divergent features.

Addressing these technical challenges will advance our understanding of GA13929's function and its relevance to metabolic regulation.

What emerging technologies might enhance our understanding of GA13929 structure and function?

Several cutting-edge approaches could advance GA13929 research:

  • Cryo-electron microscopy (cryo-EM): This rapidly advancing technique could reveal the high-resolution structure of GA13929, particularly important if the protein forms larger complexes similar to the oligomeric structure observed for D. melanogaster INOS (MW ~271,000) .

  • AlphaFold and computational modeling: AI-driven protein structure prediction tools can provide structural insights even without experimental structure determination, enabling rational design of functional studies.

  • Single-molecule enzymology: These techniques could reveal kinetic mechanisms and conformational changes during GA13929 catalytic cycle that are obscured in bulk assays.

  • Metabolic flux analysis with stable isotopes: Using isotope-labeled glucose precursors would allow researchers to track the flow of metabolites through the inositol synthesis pathway and determine how GA13929 activity influences this metabolic network.

  • Spatial transcriptomics and proteomics: These approaches could map GA13929 expression patterns with unprecedented resolution across tissues and developmental stages in D. pseudoobscura.

These technologies would provide complementary insights into GA13929 function from molecular to organismal levels.

What are the most promising research questions regarding GA13929 that remain to be addressed?

Several important questions warrant further investigation:

  • Physiological substrates: What are the primary in vivo substrates of GA13929 in D. pseudoobscura? Does it process only inositol phosphates or show broader substrate specificity like some other family members ?

  • Regulatory mechanisms: How is GA13929 activity regulated post-translationally? Are there feedback mechanisms similar to the transcriptional regulation observed for D. melanogaster Inos ?

  • Developmental roles: Given the developmental defects observed with dysregulated inositol synthesis in D. melanogaster , what specific developmental processes might require GA13929 activity in D. pseudoobscura?

  • Metabolic integration: How does GA13929 activity integrate with other metabolic pathways, particularly glucose metabolism and lipid synthesis? This question is particularly relevant given the observed effects of inositol metabolism on obesity and glucose homeostasis .

  • Evolutionary adaptation: Has GA13929 evolved specific functions in D. pseudoobscura compared to homologs in other Drosophila species, and what ecological or metabolic pressures might have driven such adaptations?

Addressing these questions would significantly advance our understanding of this enzyme's role in cellular metabolism and organismal development.

How does research on GA13929 contribute to our broader understanding of metabolic regulation across species?

GA13929 research provides several broader insights:

  • Conserved metabolic circuits: Studying inositol monophosphatases in Drosophila reveals evolutionarily conserved metabolic regulatory mechanisms that may apply across species. The observation that inositol metabolism affects obesity and glucose homeostasis in Drosophila parallels findings in mammals, suggesting fundamental conservation of these pathways .

  • Metabolism-development nexus: Research on inositol metabolism in Drosophila has revealed a critical intersection between metabolic regulation and developmental processes. Dysregulated inositol synthesis not only affects metabolic parameters but also causes severe developmental defects , highlighting how metabolic enzymes can have profound non-metabolic functions.

  • Evolutionary adaptation of enzyme function: The varying substrate specificities observed among inositol monophosphatase family members demonstrates how enzymes evolve specialized functions while maintaining structural similarity, providing insights into enzyme evolution across species.

  • Model systems for human disease: The effects of altered inositol metabolism on obesity and glucose homeostasis in Drosophila provide valuable model systems for studying human metabolic disorders, as abnormalities in myo-inositol metabolism have been implicated in type 2 diabetes, cancer, and neurodegenerative disorders .

These broader implications illustrate how focused research on GA13929 contributes to fundamental biological understanding beyond its specific enzymatic function.

What potential translational applications might emerge from a better understanding of GA13929 and related inositol monophosphatases?

Research on GA13929 and related enzymes offers several translational opportunities:

  • Novel therapeutic targets: Understanding how inositol monophosphatases regulate metabolic homeostasis could identify new drug targets for metabolic disorders. The observed effects of inositol metabolism on obesity and glucose homeostasis in Drosophila suggest potential therapeutic applications for human metabolic diseases .

  • Biomarkers for metabolic disorders: Changes in inositol monophosphatase activity or inositol metabolite profiles could serve as biomarkers for early detection or monitoring of metabolic diseases.

  • Agricultural applications: Understanding inositol metabolism in insects could lead to new strategies for pest control or crop protection by targeting species-specific aspects of these pathways.

  • Diagnostic tools: The interaction between inositol monophosphatase 1 and RAGE suggests potential for developing diagnostic tools for conditions involving this signaling axis, such as pulmonary arterial hypertension.

  • Nutritional interventions: The finding that dietary inositol affects metabolic parameters in Drosophila raises the possibility that inositol supplementation could have beneficial effects in certain human metabolic conditions, warranting clinical investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.