Recombinant Drosophila pseudoobscura pseudoobscura Sugar transporter SWEET1 (slv)

Shipped with Ice Packs
In Stock

Description

Functional Insights

SWEET1 is evolutionarily conserved across animals and plays diverse roles:

  • Developmental Roles: In Ciona intestinalis, SWEET homologs (e.g., CiRGA) are critical for notochord development .

  • Metabolic Regulation: Bovine SWEET1 homologs influence lactose concentration in milk, suggesting roles in nutrient transport .

  • Plant Comparison: Plant SWEETs (e.g., AtSWEET17, StSWEET12) transport sucrose/hexoses and mediate symbiosis with fungi .

Key Research Findings:

  • SWEET1 operates as a non-energy-dependent uniporter, distinct from ATP-driven transporters .

  • In Drosophila, SWEET1’s physiological role remains understudied compared to plant homologs, though its broad expression hints at systemic sugar homeostasis .

Applications in Research

Recombinant SWEET1 enables mechanistic studies of sugar transport. Notable applications include:

  • Biochemical Assays: Used to quantify transport kinetics and substrate specificity (e.g., glucose vs. sucrose) .

  • Pathogen Studies: Plant SWEETs are hijacked by pathogens for nutrient acquisition; animal homologs may have analogous roles .

  • Evolutionary Analyses: Comparing SWEET1 across species (e.g., nematodes lack SWEETs, while mammals retain one homolog) .

Research Gaps and Future Directions

  • Functional Redundancy: Whether D. pseudoobscura SWEET1 compensates for other transporters in sugar metabolism is unclear .

  • Structural Resolution: No crystal structure exists for animal SWEET1; bacterial SemiSWEET structures provide partial insights .

  • Disease Links: Potential roles in metabolic disorders or pathogen interactions remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
slv; GA21278; Sugar transporter SWEET1; Protein saliva
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
slv
Target Protein Sequence
MSAVAYELLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYGV LTEEQSIVLVNIIGSTLFLIYTLIYYVFTVNKRAFVRQFAFVLAVLIAVVVVYTNRLADQ RDEMIRITGIFCCIVTVCFFAAPLATLLHVIRAKNSESLPLPLIATSFLVSLQWLIYGIL ISDSFIQIPNFLGCLLSMLQLSLFVVYPPRSYSGQGYKLVEQAVPF
Uniprot No.

Target Background

Function

This protein mediates both low-affinity uptake and efflux of sugar across the membrane.

Database Links
Protein Families
SWEET sugar transporter family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

How does SWEET1 differ structurally and functionally across Drosophila melanogaster and Drosophila pseudoobscura pseudoobscura? (Advanced)

The SWEET1 proteins in D. melanogaster and D. pseudoobscura pseudoobscura share high sequence homology but exhibit species-specific differences that may impact function. While both proteins maintain the core transmembrane topology characteristic of sugar transporters, subtle amino acid variations likely affect substrate specificity and transport kinetics. To effectively study these differences, researchers should employ comparative structural modeling utilizing the available full-length sequences (both are 226 amino acids) to identify key residues that might confer functional specialization .

Experimentally, these differences can be assessed through complementation assays in heterologous expression systems, where function can be compared under identical conditions. Transport assays using radiolabeled substrates or fluorescent glucose analogs should be conducted at varying substrate concentrations to determine if kinetic parameters (Km, Vmax) differ between the orthologues. Additionally, site-directed mutagenesis targeting non-conserved residues can help identify which amino acid substitutions are responsible for any observed functional divergence .

What are the recommended expression systems for obtaining functional recombinant SWEET1 protein? (Basic)

For recombinant expression of Drosophila SWEET1 proteins, E. coli expression systems have been successfully employed as evidenced by commercially available recombinant proteins . The methodology typically involves:

  • Gene synthesis or PCR amplification of the coding sequence

  • Cloning into an expression vector with an appropriate tag (commonly His-tag)

  • Transformation into an E. coli expression strain

  • Induction of protein expression under optimized conditions

  • Purification using affinity chromatography

The resulting protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity .

For membrane proteins like SWEET1, alternative expression systems such as insect cells might provide better folding and post-translational modifications, though this approach is more resource-intensive and may require optimization of expression conditions.

What experimental techniques are most effective for studying SWEET1 transport activity? (Advanced)

To effectively characterize SWEET1 transport activity, researchers should employ a multi-faceted approach:

Reconstitution in Proteoliposomes:

  • Purify recombinant SWEET1 protein using affinity chromatography

  • Reconstitute the protein into artificial liposomes containing fluorescent glucose sensors

  • Measure transport kinetics through real-time fluorescence changes upon substrate addition

Electrophysiological Measurements:

  • Express SWEET1 in Xenopus oocytes or mammalian cell lines

  • Use patch-clamp techniques to measure substrate-induced currents

  • Determine ion coupling and electrogenic nature of transport

Radiolabeled Substrate Uptake:

  • Express SWEET1 in cellular systems with low endogenous glucose uptake

  • Measure the uptake of 14C-labeled glucose or other potential substrates

  • Determine substrate specificity by competition assays

The choice between these methods depends on the specific research question, but comprehensive characterization typically requires combining multiple approaches. When designing these experiments, researchers should consider controls with point mutations in the putative substrate binding site to confirm specificity of transport activity .

How can researchers differentiate between SWEET1-mediated transport and other glucose transport mechanisms in experimental systems? (Advanced)

Differentiating SWEET1-mediated transport from other glucose transport mechanisms requires a systematic approach:

Pharmacological Inhibition Profile:

  • Characterize SWEET1 sensitivity to known glucose transporter inhibitors (phloretin, cytochalasin B)

  • Develop an inhibition fingerprint specific to SWEET1

  • Use this profile to distinguish SWEET1 activity from other transporters

Genetic Approaches:

  • Generate SWEET1 knockout/knockdown models using CRISPR-Cas9 or RNAi

  • Compare glucose uptake in wild-type versus modified cells

  • Perform rescue experiments with wild-type and mutant SWEET1 variants

Substrate Specificity Analysis:

  • Test transport of various sugars (glucose, fructose, galactose, etc.)

  • Create a substrate preference profile

  • Compare with known profiles of other glucose transporters (GLUTs, SGLTs)

Transporter TypeGlucose AffinityFructose TransportGalactose TransportInhibition by Cytochalasin BInhibition by Phloretin
SWEET1ModerateYes (hypothesized)LimitedLimitedModerate
GLUT1HighLimitedYesHighHigh
GLUT2LowHighYesModerateModerate
GLUT4HighNoLimitedHighHigh
SGLT1HighNoYesResistantResistant

Note: The SWEET1 characteristics in this table are hypothesized based on limited available data and should be experimentally verified .

What quality control methods should be implemented when working with recombinant SWEET1 protein? (Basic)

Ensuring the quality and functionality of recombinant SWEET1 protein requires several validation steps:

Purity Assessment:

  • SDS-PAGE analysis to confirm appropriate molecular weight (approximately 25-30 kDa depending on tags)

  • Western blot using tag-specific or SWEET1-specific antibodies

  • Size exclusion chromatography to assess aggregation state

Functional Validation:

  • Substrate binding assays using tryptophan fluorescence quenching or similar techniques

  • Limited proteolysis to assess proper folding (properly folded membrane proteins show characteristic proteolytic patterns)

  • Circular dichroism to confirm secondary structure composition (SWEET1 should show high alpha-helical content)

Storage Stability Monitoring:

  • Store protein at recommended conditions (-20°C in 50% glycerol buffer)

  • Periodically test aliquots for activity

  • Avoid repeated freeze-thaw cycles

Implementing these quality control methods ensures that experimental outcomes are attributable to genuine SWEET1 activity rather than artifacts from protein degradation or misfolding .

How does Drosophila SWEET1 compare to mammalian SWEET transporters in terms of structure and function? (Basic)

Drosophila SWEET1 and mammalian SWEET1 (encoded by SLC50A1 in humans) share fundamental structural and functional characteristics while exhibiting notable differences:

Structural Similarities:

  • Both contain multiple transmembrane domains forming a pore for sugar transport

  • Both function as monomeric transporters (unlike some plant SWEETs that form oligomers)

  • Conservation of key residues in the substrate binding site

Functional Differences:

  • While both transport glucose, substrate affinity and transport kinetics likely differ

  • Tissue expression patterns vary: mammalian SWEET1 is broadly expressed and associated with lactose concentration in milk (in bovines)

  • Regulatory mechanisms and response to cellular signaling likely evolved separately

Researchers investigating SWEET1 across species should consider these differences when extrapolating findings between model systems. Complementation studies where Drosophila SWEET1 is expressed in mammalian cells (or vice versa) can help elucidate functional conservation and divergence between these orthologues .

What evolutionary insights can be gained from studying SWEET transporters across different Drosophila species? (Advanced)

Studying SWEET transporters across Drosophila species provides valuable evolutionary insights:

Selective Pressure Analysis:

  • Compare nonsynonymous to synonymous substitution rates (dN/dS) across species

  • Identify regions under purifying selection (conserved functional domains) versus positive selection

  • Correlate evolutionary rate with ecological niches and dietary preferences of different Drosophila species

Functional Divergence Testing:

  • Express SWEET1 orthologues from multiple Drosophila species in a common cellular background

  • Compare substrate specificity and transport kinetics

  • Link functional differences to adaptive evolutionary changes

Genomic Context Analysis:

  • Examine conservation of regulatory regions and expression patterns

  • Identify potential gene duplication or loss events in particular lineages

  • Investigate correlation between SWEET1 evolution and that of interacting proteins

This evolutionary approach can reveal how sugar transport mechanisms adapted to different ecological niches and metabolic requirements throughout Drosophila evolution, potentially informing broader understanding of metabolic adaptation in insects .

What is the relationship between SWEET transporters in insects and those found in plants? (Advanced)

The relationship between insect and plant SWEET transporters represents a fascinating case of convergent evolution and potentially co-evolutionary processes:

Evolutionary Relationship:

  • Plant genomes typically contain approximately 20 SWEET paralogues while most animals have only one (SWEET1)

  • Despite similar functions in sugar transport, plant and animal SWEETs evolved independently

  • Structural convergence occurred due to similar selective pressures for efficient sugar transport

Functional Comparison:

  • Plant SWEETs transport both sucrose and hexoses, while insect SWEET1 primarily transports glucose

  • Plant SWEETs play crucial roles in phloem loading, nectar secretion, and seed development

  • Plant SWEETs are frequently targeted by pathogens, suggesting a role in plant-pathogen interactions

Research Applications:

  • Studying both systems provides insights into convergent mechanisms of sugar transport

  • Understanding how pathogens manipulate plant SWEETs may inform research on insect-pathogen interactions

  • Comparative structural studies can reveal essential features for sugar transport function

This comparative approach demonstrates how similar molecular solutions evolved in divergent lineages to solve common physiological challenges of nutrient transport and energy metabolism .

How can SWEET1 studies in Drosophila inform our understanding of human glucose metabolism disorders? (Basic)

Research on Drosophila SWEET1 provides valuable insights into human glucose metabolism disorders through several mechanisms:

Model System Advantages:

  • Drosophila offers genetic tractability and rapid generation time

  • Conservation of core metabolic pathways between flies and humans

  • Ability to create specific mutations corresponding to human genetic variants

Translational Applications:

  • Identification of key residues in SWEET1 that affect glucose transport efficiency

  • Insights into how mutations might affect cellular glucose homeostasis

  • Understanding genetic modifiers that influence glucose transport phenotypes

The human orthologue of SWEET1 (SLC50A1) has been associated with milk lactose concentration in bovines, suggesting potential roles in human secretory processes . By characterizing how SWEET1 mutations affect Drosophila physiology, researchers can generate hypotheses about how SLC50A1 variants might contribute to human metabolic conditions. Additionally, high-throughput screening of compounds that modify SWEET1 function in Drosophila could identify candidate therapeutics for glucose transport disorders .

What methodological approaches should be used to investigate SWEET1's role in tissue-specific developmental processes? (Advanced)

Investigating SWEET1's role in tissue-specific developmental processes requires sophisticated methodological approaches:

Conditional Gene Manipulation:

  • Generate tissue-specific SWEET1 knockout/knockdown using Gal4-UAS system in Drosophila

  • Create temporal control using temperature-sensitive Gal80ts or drug-inducible systems

  • Analyze phenotypic consequences in specific tissues at defined developmental stages

Live Imaging of Glucose Dynamics:

  • Express fluorescent glucose sensors (FRET-based) in specific tissues

  • Combine with SWEET1 manipulation to visualize altered glucose flux

  • Perform time-lapse imaging during key developmental transitions

Multi-omics Integration:

  • Perform transcriptomics, proteomics, and metabolomics on tissues with altered SWEET1 expression

  • Identify downstream effects on metabolic pathways and gene networks

  • Construct computational models of how SWEET1-mediated glucose transport influences developmental metabolic programs

These approaches would be particularly valuable for understanding the role of SWEET1 in embryonic development, as suggested by studies of the CiRGA homologue (SWEET1) in sea squirt Ciona intestinalis, which is essential for tissue differentiation during embryogenesis, especially the development of the notochord .

How might SWEET1 function influence host-pathogen interactions in insect models? (Advanced)

SWEET1 function may significantly impact host-pathogen interactions in insect models through several mechanisms:

Pathogen Nutrient Acquisition:

  • Pathogens may exploit or manipulate SWEET1 to access host sugars, similar to how plant pathogens target plant SWEET transporters

  • SWEET1 expression levels may change during infection as part of host defense or pathogen manipulation

  • Genetic variation in SWEET1 might contribute to differential susceptibility to pathogens

Methodological Approach:

  • Compare SWEET1 expression before and after pathogen challenge using qRT-PCR and immunoblotting

  • Create SWEET1 variants resistant to pathogen manipulation and test for altered infection outcomes

  • Develop small molecule inhibitors of SWEET1 and test their effects on pathogen proliferation

Research Implications:

  • Findings could inform development of novel insect pest control strategies

  • May provide insights into analogous processes in human infectious diseases

  • Could lead to new approaches for protecting agricultural crops from pathogens that target SWEET transporters

These studies would build upon observations in plant systems, where SWEET genes are associated with pathogen susceptibility . The parallels between plant and animal systems could reveal conserved mechanisms by which pathogens manipulate host metabolism for their benefit .

What are the optimal buffer conditions for maintaining SWEET1 stability during purification and functional assays? (Basic)

Maintaining SWEET1 stability during purification and functional assays requires careful consideration of buffer conditions:

Recommended Buffer Components:

  • Base buffer: Tris-HCl (pH 7.4-8.0) at 20-50 mM

  • Stabilizing agents: 50% glycerol for storage; 10-15% glycerol for working solutions

  • Salt concentration: 100-150 mM NaCl to maintain ionic strength

  • Reducing agents: 1-5 mM DTT or 2-10 mM β-mercaptoethanol to prevent oxidation of cysteine residues

  • Protease inhibitors: Complete protease inhibitor cocktail during purification

Storage Recommendations:

  • Store stock protein at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Keep working aliquots at 4°C for up to one week

Functional Assay Considerations:

  • For transport assays, use physiological pH (7.2-7.4)

  • Include glucose at physiologically relevant concentrations (5-10 mM)

  • Consider including ATP (1-5 mM) to maintain any energy-dependent processes

These conditions should be optimized empirically for each specific experimental setup, as the optimal environment may vary depending on the specific SWEET1 orthologue, expression system, and experimental design .

How can researchers effectively distinguish between direct and indirect effects when manipulating SWEET1 expression in vivo? (Advanced)

Distinguishing between direct and indirect effects of SWEET1 manipulation requires rigorous experimental design:

Rescue Experiments:

  • After SWEET1 knockdown/knockout, reintroduce:

    • Wild-type SWEET1 (should restore normal phenotype)

    • Transport-deficient SWEET1 mutant (should not rescue if effects are direct)

    • SWEET1 from other species (to test functional conservation)

  • Quantify the degree of phenotypic rescue for each construct

Temporal Control Systems:

  • Use inducible expression systems (e.g., Gal80ts in Drosophila)

  • Monitor how quickly phenotypes appear after SWEET1 manipulation

  • Direct effects typically manifest faster than indirect consequences

Tissue-Specific Analysis:

  • Restrict SWEET1 manipulation to specific tissues

  • Compare affected versus unaffected tissues

  • Use cell-autonomous markers to distinguish between cell-autonomous and non-autonomous effects

Metabolomic Profiling:

  • Perform untargeted metabolomics after SWEET1 manipulation

  • Identify immediate metabolic changes (direct effects) versus downstream adaptations

  • Create a temporal map of metabolic changes following SWEET1 perturbation

By systematically applying these approaches, researchers can build a causative model separating direct consequences of altered glucose transport from secondary adaptations or compensatory mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.