Recombinant Drosophila pseudoobscura pseudoobscura Threonylcarbamoyladenosine tRNA methylthiotransferase (GA19679)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

  • Catalytic Mechanism:

    • Step 1: Methyl transfer from SAM to the auxiliary [4Fe-4S] cluster.

    • Step 2: Radical-mediated sulfur transfer to tRNA’s A37 .

  • Cofactors: Two [4Fe-4S] clusters and SAM are essential for activity .

  • Substrate Specificity: Modifies tRNAs with the anticodon loop sequence ANN (e.g., tRNA^Phe, tRNA^Thr) .

Activity Notes:

  • Functions optimally with NADPH/FMN or dithionite as reductants .

  • Exhibits reduced activity on hypermodified hn6A-containing tRNAs .

Functional Insights

GA19679 is homologous to human CDKAL1, a tRNA-modifying enzyme linked to type 2 diabetes . Its role includes:

  • Translational Accuracy: Methylthiolation prevents ribosomal frameshifting .

  • tRNA Stability: Protects tRNA from degradation by RNases .

  • Evolutionary Conservation: Shares functional overlap with bacterial MtaB and archaeal MiaB homologs .

Research Applications

ApplicationUse CaseSource
tRNA Modification StudiesCharacterizing ms²t⁶A biosynthesis
Disease ModelingStudying CDKAL1-linked metabolic disorders
Structural BiologyRadical SAM enzyme mechanisms

Key References

  1. Structural Basis for tRNA Methylthiolation (PMCID: PMC9107155) .

  2. Archaeal MTTase Function (Front. Microbiol., 2023) .

  3. Eukaryotic MTTase Homologs (PMCID: PMC2937867) .

  4. Recombinant Protein Specifications (Creative BioMart) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include your requirement in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GA19679; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDKAL1-like protein; tRNA-t(6A37 methylthiotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
GA19679
Target Protein Sequence
MQQLEQDFPGNDIDDIEDLISAEDVKPQERYQNKKSVTVRAKKRVQIKPETDAEEKPTPR PTIYESVIPGTQKVFVKTWGCAHNNSDSEYMAGQLAAYGYKLSGKDEADLWLLNSCTVKN PSEDTFRNEIESGMSNGKHIVVAGCVPQGAPKSDYLRGLSVIGVQQIDRVVEVVEETLKG HSVRLLQNKKVHGRRVAGAPLSLPKVRKNPLIEIISINTGCLNQCTYCKTKHARGDLASY PPEEIVDRARQSFAEGCCEIWLTSEDTGAYGRDIGSSLPELLWKLVEVIPEHCMLRVGMT NPPYILEHLEEVAKVLQHPRVYAFLHVPVQSGSDSVLGEMKREYCRKDFEHVVDFLRERV PGVTIATDIICGFPTETEEDFEETMTLCGRYRFPSLFINQFFPRPGTPAAKMERIPANLV KKRTKRLTDLFYSYEPYAQRVGEMYTVLVTEISHDKLHYVGHNKSYEQVLLPMRDNLLGT RVHVRITSVSKFSMVGEILDDERDWTRCAKKQEAPMELTITGRNRDKLIQRYVGIALVVG SLAFLLQLLIRFL
Uniprot No.

Target Background

Function
This enzyme catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), resulting in the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that recognize codons beginning with adenine.
Database Links
Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is threonylcarbamoyladenosine tRNA methylthiotransferase in Drosophila pseudoobscura?

Threonylcarbamoyladenosine tRNA methylthiotransferase in Drosophila pseudoobscura is an enzyme responsible for methylthiolation of specific tRNAs. It belongs to the MtaB-like class of methylthiotransferases (MTTases) that act on C2 of N6-(threonylcarbamoyl)adenosine (t6A), which is typically found at position 37 in certain tRNAs such as tRNALys(UUU) . This enzyme contains iron-sulfur clusters essential for its catalytic activity, including a [Fe4S4] radical SAM cluster responsible for reductive cleavage and an [Fe4S4] auxiliary cluster likely involved in sulfur incorporation during the modification process .

How does GA19679 compare to related methylthiotransferases in other organisms?

GA19679 in Drosophila pseudoobscura is functionally similar to CDKAL1 in humans and other MtaB-like methylthiotransferases across species. In comparison:

  • Human ortholog CDKAL1: Acts on tRNALys(UUU), and dysfunction is strongly associated with type 2 diabetes risk across all ethnic groups

  • MiaB in bacteria: Modifies isopentenyladenosine (i6A) at position 37 to 2-methylthio-N6-isopentenyladenosine (ms2i6A)

  • CDK5RAP1 in humans: Mitochondrially located enzyme responsible for modifying mitochondrial tRNAs for Ser(AGN), Phe, Tyr, and Trp at nucleotide i6A37; also regulates cyclin-dependent kinase 5 and is implicated in central nervous system function and various cancers

The structural and functional conservation of these enzymes highlights their evolutionary importance in tRNA modification pathways across different species.

What is the molecular mechanism of methylthiolation performed by GA19679?

The methylthiolation reaction catalyzed by GA19679 likely follows a two-step mechanism similar to other characterized MTTases:

  • Initial phase: A methyl group from S-adenosylmethionine (SAM) is transferred to a sulfur species associated with the [Fe4S4] auxiliary cluster

  • Transfer phase: The resulting methylthio group is transferred intact to C2 of the target nucleoside (t6A37) in a radical-dependent reaction

This process requires reductive cleavage of SAM by the [Fe4S4] radical SAM cluster to generate a 5'-deoxyadenosyl radical (5'-dA- ), which initiates the radical-based chemistry necessary for the modification . Both reaction steps appear to utilize a single SAM binding site, similar to the mechanism observed in class A radical SAM methylases RlmN and Cfr .

What techniques are most effective for purifying recombinant GA19679 for in vitro studies?

For optimal purification of recombinant GA19679, researchers should implement the following methodological approach:

  • Expression system selection:

    • Use E. coli BL21(DE3) containing pRKISC plasmid (encoding iron-sulfur cluster assembly machinery)

    • Express under anaerobic conditions to preserve iron-sulfur cluster integrity

    • Utilize a expression vector with an N-terminal His6 or His6-SUMO tag for purification

  • Purification protocol:

    • Perform all steps in an anaerobic chamber (<2 ppm O₂)

    • Lyse cells using BugBuster reagent supplemented with DNase I, lysozyme, and protease inhibitors

    • Conduct initial purification via Ni-NTA affinity chromatography

    • Apply size exclusion chromatography using Superdex 200 column

    • Include DTT (2 mM) in all buffers to maintain reducing conditions

  • Quality assessment:

    • Verify purity via SDS-PAGE (>95% homogeneity)

    • Confirm iron-sulfur cluster incorporation via UV-visible spectroscopy (characteristic absorbance at 410 nm)

    • Assess protein folding using circular dichroism spectroscopy

This approach has been adapted from successful purification protocols for related methylthiotransferases and optimized for preserving enzymatic activity .

How can researchers effectively measure the enzymatic activity of GA19679 in vitro?

An effective assay system for measuring GA19679 enzymatic activity should incorporate:

  • Substrate preparation:

    • Synthesize or purify appropriate tRNA substrates (particularly tRNALys)

    • Ensure substrates contain the t6A modification at position 37

    • Verify substrate integrity via gel electrophoresis and mass spectrometry

  • Reaction conditions:

    • Buffer composition: 50 mM HEPES (pH 7.5), 150 mM NaCl, 10 mM MgCl₂

    • Required components: 2 mM DTT, 200 μM SAM, 1 mM sodium dithionite

    • Iron-sulfur cluster reconstitution components: Fe(NH₄)₂(SO₄)₂, Na₂S

    • Temperature: 30°C under anaerobic conditions

  • Activity measurement methods:

    • Mass spectrometry (MALDI-TOF or LC-MS/MS) to detect the ms2t6A modification

    • HPLC analysis of nucleosides after enzymatic digestion of tRNA

    • Radioisotope labeling using [methyl-³H]-SAM to track methyl transfer

  • Controls and validation:

    • Include negative controls (enzyme without substrate, substrate without enzyme)

    • Use known MTTase enzymes (e.g., MiaB) as positive controls

    • Verify results with multiple analytical methods

This comprehensive methodology enables reliable quantification of GA19679 activity and facilitates comparison with other tRNA modification enzymes .

What genetic tools are available for studying GA19679 function in vivo in Drosophila pseudoobscura?

The following genetic tools and methodologies are recommended for in vivo analysis:

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 system for generating precise gene knockouts

    • RNAi using the GAL4-UAS system for tissue-specific knockdown

    • P-element or piggyBac transposon-based mutagenesis

  • Expression systems:

    • UAS-GA19679 constructs for controlled overexpression

    • Tissue-specific GAL4 drivers (e.g., Tubulin-GAL4 for ubiquitous expression)

    • Temperature-sensitive GAL80 system for temporal control of expression

  • Phenotypic analysis methods:

    • Lifespan assessment (similar to measurements in CG7009/CG5220 mutants)

    • RNA virus infection susceptibility assays

    • Small RNA pathway function tests

    • Developmental timing measurements

  • Molecular analysis techniques:

    • MALDI-TOF mass spectrometry for tRNA modification analysis

    • RiboMethSeq mapping for comprehensive modification profiling

    • RT-qPCR for expression level quantification

    • RNA-seq for transcriptome-wide effects

These approaches can be implemented in combination with genetic background variation studies using the Drosophila Genetic Reference Panel (DGRP) to identify genetic modifiers .

How does structural analysis inform our understanding of GA19679 substrate specificity?

Recent structural analyses of related methylthiotransferases provide insights into GA19679 substrate specificity:

The structural basis for substrate recognition likely includes:

  • Domain-specific interactions:

    • TRAM domain recognition of U33 (universally conserved in tRNAs)

    • RS domain recognition of specific nucleotides in the anticodon loop

    • MTTase domain engagement with the target nucleoside (t6A37)

  • Key structural elements determining specificity:

    • Phe residues in the RS domain likely form stacking interactions with A36

    • Positively charged residues in the MTTase domain interact with the phosphate backbone

    • A hydrophobic pocket accommodates the threonylcarbamoyl modification of t6A

  • Selectivity mechanisms:

    • The enzyme shows exquisite selectivity for properly modified substrates

    • Recognition appears to depend on both nucleotide identity and existing modifications

    • Structural constraints prevent modification of inappropriate targets

Researchers should consider these structural insights when designing experiments to study GA19679 specificity or when engineering the enzyme for novel applications.

What is the relationship between GA19679 function and RNA virus resistance in Drosophila pseudoobscura?

The relationship between GA19679 function and RNA virus resistance likely parallels observations in Drosophila melanogaster, where tRNA modification enzymes influence antiviral immunity:

  • Potential mechanisms:

    • Disruption of tRNA modification may alter translation efficiency of viral proteins

    • Modified tRNAs may serve as signals in innate immune response pathways

    • Changes in translation fidelity could affect viral RNA recognition systems

  • Experimental evidence from related systems:

    • Drosophila melanogaster with mutations in tRNA 2'-O-methylation enzymes (CG7009/CG5220) show increased sensitivity to RNA virus infections

    • Small RNA pathway dysfunction observed in tRNA modification mutants may compromise RNAi-based antiviral defense

    • Altered stress responses in modification enzyme mutants could impact cellular defense mechanisms

  • Research approach recommendations:

    • Compare virus replication rates in GA19679 mutant versus wild-type flies

    • Analyze small RNA profiles (particularly siRNAs) in response to viral infection

    • Assess changes in translation efficiency of viral proteins

    • Examine potential interactions between GA19679 and known antiviral factors

This research direction could reveal novel connections between tRNA modifications and antiviral immunity mechanisms .

How does GA19679 interact with the ERAD pathway in Drosophila pseudoobscura?

The interaction between GA19679 and the Endoplasmic Reticulum-Associated Degradation (ERAD) pathway represents an emerging research direction:

  • Potential connection points:

    • GA19679 may influence translation of key ERAD components

    • Modification of specific tRNAs could affect protein folding quality control

    • GA19679 might interact with ERAD components through non-canonical functions

  • Evidence from related pathways:

    • Several ERAD components (CG8405, CG42383, and Hrd3) were identified as genetic modifiers in NGLY1 deficiency screens

    • At least 12 genes identified in genetic screens are involved in protein homeostasis

    • ERAD dysfunction has been linked to altered RNA modification pathways in multiple model systems

  • Experimental approaches to investigate this relationship:

    • Genetic interaction studies (double mutant analysis with ERAD components)

    • Proteomic analysis of protein stability in GA19679 mutants

    • Assessment of ER stress markers in GA19679-deficient flies

    • Co-immunoprecipitation experiments to identify physical interactions

This research direction could reveal novel connections between tRNA modification and protein quality control systems .

How do environmental stressors influence GA19679 activity and subsequent tRNA modifications?

Environmental stress responses likely modulate GA19679 activity with significant downstream consequences:

  • Stress conditions of interest:

    • Temperature stress (heat shock and cold shock)

    • Oxidative stress (paraquat, hydrogen peroxide exposure)

    • Nutritional stress (amino acid starvation)

    • Hypoxia

  • Potential regulatory mechanisms:

    • Transcriptional regulation of GA19679 expression

    • Post-translational modifications affecting enzyme activity

    • Changes in cellular redox state influencing iron-sulfur cluster integrity

    • Altered substrate availability under stress conditions

  • Methodological approach:

    • Measure GA19679 expression and activity under various stress conditions

    • Quantify changes in tRNA modification profiles using mass spectrometry

    • Analyze translational efficiency and fidelity changes during stress

    • Assess stress resistance in GA19679 mutant versus wild-type flies

  • Expected outcomes:

    • Identification of stress-responsive regulation of GA19679

    • Correlation between modification changes and stress adaptation

    • Potential discovery of stress-specific tRNA modification patterns

This research direction could reveal how environmental factors influence tRNA modification dynamics and their impact on cellular physiology.

What are the implications of GA19679 research for understanding human diseases linked to tRNA modification defects?

Research on GA19679 has significant translational implications for human disease:

  • Direct human orthologs with disease associations:

    • CDKAL1: Strong association with type 2 diabetes risk across all ethnic groups

    • CDK5RAP1: Implicated in central nervous system function and various cancers

  • Mechanistic insights from Drosophila research:

    • The conserved two-step mechanism of methylthiolation provides targets for therapeutic intervention

    • Substrate recognition principles may inform drug design strategies

    • Phenotypic consequences in flies can predict human disease manifestations

  • Comparative analysis value:

    • Studying GA19679 in Drosophila provides a genetically tractable model system

    • Evolutionary conservation of tRNA modification pathways enables translational insights

    • Disease-associated variants can be modeled and characterized

  • Therapeutic development potential:

    • Identification of small molecules that modulate methylthiotransferase activity

    • Development of compensatory mechanisms to restore translation fidelity

    • Screening for genetic modifiers that suppress pathological phenotypes

This research has particular relevance for understanding metabolic disorders, neurodegenerative conditions, and cancer biology where tRNA modifications play significant roles .

How can high-throughput methods be applied to study GA19679 function and its genetic interactions?

Modern high-throughput approaches offer powerful tools for comprehensive analysis:

  • Genome-wide association studies:

    • Cross GA19679 mutants with Drosophila Genetic Reference Panel (DGRP) strains

    • Measure phenotypic outcomes across diverse genetic backgrounds

    • Identify genetic variants that modify GA19679-related phenotypes

    • Apply linear mixed models for statistical analysis of variant associations

  • Transcriptome-wide profiling:

    • RNA-seq analysis in GA19679 mutants versus wild-type

    • Ribosome profiling to assess translational impacts

    • Small RNA sequencing to examine effects on regulatory RNAs

    • Comparative analysis across different stress conditions

  • Proteomics approaches:

    • Quantitative proteomics to identify proteome-wide changes

    • Pulse-chase experiments to measure protein stability changes

    • Protein interaction mapping via BioID or proximity labeling

    • Post-translational modification analysis

  • Computational analysis strategies:

    • Evolutionary rate covariation (ERC) analysis to identify co-evolving genes

    • Machine learning approaches to predict functional interactions

    • Systems biology modeling of tRNA modification networks

    • Comparative genomics across Drosophila species

These approaches can generate comprehensive datasets to place GA19679 function in broader cellular and evolutionary contexts .

What are the primary challenges in expressing and purifying active recombinant GA19679?

Working with recombinant GA19679 presents several technical challenges:

  • Iron-sulfur cluster integrity:

    ChallengeSolution
    Oxygen sensitivityPerform all purification steps anaerobically (<2 ppm O₂)
    Incomplete cluster incorporationCo-express with iron-sulfur cluster assembly machinery
    Cluster degradation during storageStore enzyme with reducing agents and oxygen scavengers
  • Solubility issues:

    ChallengeSolution
    AggregationUse solubility-enhancing tags (SUMO, MBP, or TrxA)
    Inclusion body formationOptimize expression temperature (16-18°C)
    Limited yieldExpress in specialized strains (e.g., SHuffle, OrigamiB)
  • Enzymatic activity:

    ChallengeSolution
    Low activityReconstitute iron-sulfur clusters in vitro
    Substrate accessibilityEnsure proper tRNA folding before assays
    Assay sensitivityDevelop targeted mass spectrometry approaches
  • Structural characterization challenges:

    ChallengeSolution
    Conformational heterogeneityUse limited proteolysis to identify stable domains
    Crystallization difficultiesTry in complex with substrate analogs or tRNA fragments
    Sensitivity to oxidationEmploy rapid freezing techniques for cryo-EM studies

These technical considerations are essential for successful biochemical and structural characterization of GA19679 .

How can researchers effectively analyze the global impact of GA19679 on the tRNA modification landscape?

Comprehensive analysis of the tRNA modification landscape requires integrated methodologies:

  • Mass spectrometry approaches:

    • MALDI-TOF mass spectrometry for targeted analysis of specific tRNAs

    • LC-MS/MS for comprehensive nucleoside modification profiling

    • Comparative analysis between wild-type and mutant samples

    • Quantitative approaches using stable isotope labeling

  • Next-generation sequencing methods:

    • RiboMethSeq for mapping of 2'-O-methylation sites

    • AlkAniline-Seq for detecting N⁶-isopentenyladenosine modifications

    • HAMR (High-throughput Annotation of Modified Ribonucleotides)

    • Nanopore direct RNA sequencing for modification detection

  • Integrative analysis strategies:

    • Correlation of modification changes with transcriptomic alterations

    • Ribosome profiling to connect modifications with translation efficiency

    • Systems biology modeling of modification networks

    • Machine learning approaches to predict modification sites

  • Validation techniques:

    • Northern blot analysis with modification-specific probes

    • In vitro modification assays with purified components

    • Genetic complementation studies

    • Targeted mutation of modification sites

This multi-faceted approach enables comprehensive characterization of how GA19679 activity shapes the global tRNA modification landscape .

What considerations are important when designing CRISPR-based approaches for GA19679 functional studies?

CRISPR-based genome editing for GA19679 requires careful experimental design:

  • Guide RNA selection considerations:

    ConsiderationRecommendation
    On-target efficiencySelect guides with predicted efficiency scores >0.6
    Off-target effectsChoose guides with minimal predicted off-targets
    Structural constraintsTarget conserved catalytic domains
    Genetic backgroundConsider strain-specific variations in target sequences
  • Experimental design strategies:

    StrategyImplementation
    Complete knockoutDesign guides targeting early exons
    Domain-specific mutationsUse HDR to introduce precise mutations in catalytic residues
    Conditional allelesImplement floxed alleles with tissue-specific Cre expression
    Tagged versionsIncorporate epitope tags via HDR for localization studies
  • Validation requirements:

    Validation approachMethod
    Genomic verificationPCR and sequencing of targeted region
    Expression analysisRT-qPCR and Western blotting
    Functional validationMass spectrometry of tRNA modifications
    Off-target assessmentWhole-genome sequencing or targeted sequencing
  • Control considerations:

    Control typePurpose
    Wild-type controlsBaseline comparison
    Rescued mutantsConfirm phenotype specificity
    HeterozygotesAssess dosage sensitivity
    Alternative allelesRule out background effects

These design considerations ensure rigorous genetic analysis of GA19679 function while minimizing experimental artifacts and confounding factors.

What emerging technologies could advance our understanding of GA19679 function?

Several cutting-edge technologies show promise for future GA19679 research:

  • Cryo-electron microscopy:

    • High-resolution structural analysis of GA19679-tRNA complexes

    • Visualization of conformational states during catalysis

    • Structural determination of the complete modification complex

  • Single-molecule techniques:

    • FRET analysis to monitor enzyme-substrate interactions in real-time

    • Optical tweezers to study mechanical aspects of tRNA-enzyme binding

    • Single-molecule sequencing for direct detection of tRNA modifications

  • Advanced genetic approaches:

    • Prime editing for precise introduction of specific modifications

    • CRISPRi/CRISPRa for temporal control of GA19679 expression

    • Base editing for introducing specific amino acid changes

  • Computational advances:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Molecular dynamics simulations of the modification process

    • Deep learning approaches for predicting modification impacts

  • Spatial transcriptomics:

    • Visualization of modified tRNAs in different cellular compartments

    • Tissue-specific modification profiling

    • Correlation of modification patterns with cellular states

These technologies will enable unprecedented insights into the structural basis, dynamic properties, and cellular contexts of GA19679 function .

How might evolutionary analysis of methylthiotransferases across Drosophila species inform our understanding of GA19679?

Evolutionary analysis provides valuable context for understanding GA19679 function:

  • Comparative genomics approaches:

    • Sequence analysis across Drosophila species to identify conserved domains

    • Evolutionary rate analysis to identify functionally critical residues

    • Synteny analysis to examine genomic context conservation

    • Identification of species-specific adaptations

  • Evolutionary rate covariation (ERC) analysis:

    • Identification of genes that co-evolve with GA19679

    • Network analysis of functionally related genes

    • Detection of lineage-specific patterns of selection

    • Correlation with ecological and environmental factors

  • Cross-species functional studies:

    • Complementation experiments across species

    • Comparison of substrate specificity between orthologs

    • Analysis of species-specific modification patterns

    • Correlation with species-specific physiological traits

  • Ancestral sequence reconstruction:

    • Resurrection of ancient methylthiotransferase enzymes

    • Biochemical characterization of ancestral enzymes

    • Tracking the evolution of substrate specificity

    • Identification of key mutations that altered function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.