Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628 (GA21628)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628 (GA21628) is a protein that is offered by Creative BioMart for life sciences research . These products undergo rigorous testing to ensure they meet demanding research needs .

Basic Information Table

CategoryDescription
Official Full NameRecombinant Full Length Drosophila Pseudoobscura Pseudoobscura Upf0389 Protein Ga21628(Ga21628) Protein, His-Tagged
Source (Host)E. coli
SpeciesDrosophila pseudoobscura pseudoobscura (Fruit fly)
TagHis
Protein LengthFull Length (1-127)

Function and Pathways

GA21628 is involved in several pathways and performs different roles within them . Creative BioMart lists the pathways in which GA21628 participates, which may be useful for reference . Additionally, other proteins involved in the same pathways as GA21628 are also listed, and many are available on the Creative BioMart website .

GA21628 also has several biochemical functions, some of which are performed in cooperation with other proteins, while others are performed by GA21628 alone . Creative BioMart has selected the most prominent functions of GA21628 and listed some proteins that share these functions .

Interactions

GA21628 directly interacts with other proteins and molecules, and these interactions have been detected through methods such as yeast two-hybrid assays, co-IP, and pull-down assays . Creative BioMart provides a list of proteins and molecules that interact with GA21628, many of which are available on their site . This information can be useful in researching GA21628 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
GA21628; UPF0389 protein GA21628
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Target Names
GA21628
Target Protein Sequence
MFNKSALIGSLLRRSFGTTNPLRQAIKNHQPNEMEKRFLVWSGKYKSQAEVPAFVSQDEM ERVRNKMRIRLANIMIALTVIGCGIMVYSGKQAAKRGESVSKMNLEWHKQFNELKPEGGA AAPASTK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0389 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the UPF0389 protein GA21628 and what is its significance in Drosophila research?

The UPF0389 protein GA21628 (UniProt ID: Q29DG0) is a 127-amino acid protein from Drosophila pseudoobscura pseudoobscura, a species of fruit fly extensively used in laboratory studies of speciation and population genetics . D. pseudoobscura has significant historical importance in evolutionary biology research, having been used by Theodosius Dobzhansky and colleagues for pioneering analyses of natural selection and population genetics . This species was the second Drosophila species to have its genome sequenced in 2005, after the model organism D. melanogaster .

While the specific function of the UPF0389 protein GA21628 is not fully characterized (hence the "UPF" designation, which stands for "Uncharacterized Protein Family"), studying this protein can provide insights into:

  • Evolutionary conservation of uncharacterized protein families across species

  • Molecular mechanisms underlying speciation in Drosophila

  • Structural and functional protein analysis in non-model organisms

How is recombinant D. pseudoobscura UPF0389 protein GA21628 typically expressed and purified?

The recombinant UPF0389 protein GA21628 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The standard methodology follows this workflow:

  • Cloning and Vector Construction:

    • The full-length gene (encoding residues 1-127) is inserted into an appropriate expression vector

    • The construct includes an N-terminal histidine tag for purification purposes

  • Expression Conditions:

    • Transformation into competent E. coli cells

    • Culture in appropriate media with antibiotic selection

    • Induction of protein expression (typically using IPTG for T7 promoter-based systems)

  • Purification Protocol:

    • Cell lysis under native conditions (buffer optimization may be required)

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Further purification using size-exclusion chromatography if necessary

    • The purified protein typically achieves >90% homogeneity as determined by SDS-PAGE

  • Storage:

    • The protein is typically stored lyophilized or in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For longer-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended

    • Working aliquots can be kept at 4°C for up to one week

What experimental design approaches can optimize recombinant expression of UPF0389 protein GA21628?

Multivariate experimental design offers significant advantages over traditional univariate methods for optimizing recombinant protein expression . For UPF0389 protein GA21628 expression, consider implementing the following approach:

  • Define Critical Factors for Testing:

    • Temperature (typically test range: 16-37°C)

    • Inducer concentration (IPTG: 0.1-1.0 mM)

    • Media composition (complex vs. defined media)

    • Induction time (early/mid/late log phase)

    • Post-induction incubation time (4-24 hours)

  • Design of Experiments (DoE) Implementation:

    • Use fractional factorial design to screen significant factors

    • Apply response surface methodology (RSM) for optimization

    • Set protein solubility and yield as primary response variables

  • Analysis of Results:

    • Construct Pareto charts to identify statistically significant factors

    • Employ analysis of variance (ANOVA) to evaluate factor interactions

    • Generate contour plots to visualize optimal conditions

This approach has been shown to increase soluble protein yields by 3-5 fold in various recombinant expression systems compared to conventional optimization methods . For UPF0389 protein GA21628, particular attention should be paid to temperature and induction conditions as these often significantly impact the solubility of recombinant proteins.

How can researchers improve the success rate of UPF0389 protein GA21628 expression using mRNA structure optimization?

Recent research has shown that the accessibility of translation initiation sites significantly impacts recombinant protein expression success . For optimizing UPF0389 protein GA21628 expression:

  • mRNA Structure Analysis:

    • Analyze the mRNA secondary structure around the translation initiation site using software tools (e.g., RNAfold, mFold)

    • Calculate the accessibility of the Shine-Dalgarno sequence and start codon

  • Sequence Optimization Strategy:

    • Implement synonymous codon substitutions in the first 9 codons to reduce mRNA secondary structure stability

    • Use the TIsigner approach that employs simulated annealing algorithms to modify codons while maintaining the amino acid sequence

    • Target increased base-unpairing probability across the Boltzmann ensemble

  • Validation and Implementation:

    • Compare expression levels between optimized and non-optimized constructs

    • Measure protein yields quantitatively using appropriate assays

Studies have demonstrated that mRNA accessibility optimization can significantly improve expression success rates, with accessibility models outperforming traditional codon optimization approaches . In a large-scale study of 11,430 recombinant proteins, accessibility of translation initiation sites was the strongest predictor of expression success in E. coli .

What analytical methods should be used to verify the integrity and functionality of recombinant UPF0389 protein GA21628?

A comprehensive analytical workflow should be employed to ensure the integrity and proper folding of recombinant UPF0389 protein GA21628:

Analytical MethodPurposeCritical Parameters
SDS-PAGEPurity assessment and molecular weight confirmationShould show >90% purity with a band at ~14 kDa (plus tag size)
Western blotIdentity confirmationUse anti-His antibodies or protein-specific antibodies if available
Mass spectrometryExact mass determination and post-translational modificationsMALDI-TOF or ESI-MS/MS for sequence coverage
Circular dichroismSecondary structure assessmentFar-UV spectrum (190-260 nm) to determine α-helix and β-sheet content
Size-exclusion chromatographyOligomeric state determinationShould match predicted molecular weight for monomeric or physiologically relevant oligomeric states
Thermal shift assayProtein stability assessmentFluorescence-based monitoring of protein unfolding with temperature increase

For UPF0389 protein GA21628, where the specific function is not well-characterized, additional functional assays may need to be developed based on bioinformatic predictions of potential functions or through activity screening approaches.

How might UPF0389 protein GA21628 contribute to understanding genetic divergence and speciation in Drosophila?

The UPF0389 protein GA21628 can serve as a molecular marker for studying genetic divergence between Drosophila species and subspecies. Research strategies include:

  • Comparative Sequence Analysis:

    • Compare GA21628 sequences between D. pseudoobscura pseudoobscura and D. pseudoobscura bogotana to identify fixed amino acid differences

    • Analyze these differences in the context of reproductive isolation mechanisms

    • Calculate Ka/Ks ratios to determine selective pressures on this protein

  • Expression Pattern Analysis:

    • Examine tissue-specific expression patterns across Drosophila species

    • Investigate potential differences in expression regulation that might contribute to speciation

    • Study expression in hybrids to identify potential misregulation patterns

  • Functional Divergence Assessment:

    • Test whether sequence differences translate to functional differences

    • Investigate whether GA21628 might be involved in reproductive isolation mechanisms

This approach aligns with research on other genes in Drosophila pseudoobscura, where divergence of X-linked transcription factors has been identified within major sterility loci between subspecies . For example, the Ovd transcription factor showed significant fixed amino acid changes between D. p. pseudoobscura and D. p. bogotana, with 52 putative target genes identified through transcriptomic analysis of sterile and fertile hybrids .

How can researchers investigate potential transcriptional regulation functions of UPF0389 protein GA21628?

If UPF0389 protein GA21628 is suspected to have transcriptional regulation functions, a systematic approach to investigate this would include:

  • DNA-Binding Assay Methodology:

    • Electrophoretic mobility shift assays (EMSA) to test binding to DNA

    • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify genomic binding sites

    • DNase I footprinting to determine specific binding sequences

  • Transcriptional Activity Assessment:

    • Reporter gene assays using potential target promoters

    • In vitro transcription assays to test direct effects on transcription

    • RNA-seq in GA21628 knockdown or overexpression conditions

  • Protein Interaction Studies:

    • Co-immunoprecipitation to identify interacting transcription factors

    • Yeast two-hybrid screening for protein interaction partners

    • Biolayer interferometry to determine binding kinetics with potential partners

This methodological framework parallels approaches used to study other transcription factors in Drosophila, such as the transcription factor Ovd, which was found to regulate 52 target genes associated with hybrid sterility between D. p. pseudoobscura and D. p. bogotana .

What approaches can be used to study UPF0389 protein GA21628 in the context of population genetics and natural selection?

To investigate UPF0389 protein GA21628 in the context of population genetics and natural selection:

  • Population Sampling and Sequencing Strategy:

    • Collect D. pseudoobscura samples from diverse geographic locations

    • Sequence the GA21628 gene from multiple individuals per population

    • Analyze polymorphism patterns within and between populations

  • Selection Analysis Methodology:

    • Calculate nucleotide diversity (π) and population differentiation (FST)

    • Perform tests for selection (Tajima's D, Fu & Li's F, McDonald-Kreitman test)

    • Compare synonymous vs. non-synonymous substitution rates

  • Experimental Evolution Approach:

    • Subject D. pseudoobscura populations to varying selection pressures

    • Track changes in GA21628 allele frequencies over generations

    • Correlate genetic changes with fitness components

This framework draws on the rich history of selection studies in D. pseudoobscura populations, where components of fitness including viability and fertility have been shown to be frequency-dependent and density-dependent . Previous research with D. pseudoobscura has demonstrated that rare genotypes often have a selective advantage, and that both major components of fitness (viability and fertility) contribute approximately equally to changing gene frequencies .

What strategies can resolve poor solubility of recombinant UPF0389 protein GA21628?

Poor solubility is a common challenge in recombinant protein expression. For UPF0389 protein GA21628, implement the following methodological approaches:

  • Expression Condition Optimization:

    • Reduce expression temperature to 16-20°C to slow protein synthesis

    • Use auto-induction media to achieve gradual protein expression

    • Test different E. coli host strains (BL21(DE3), Rosetta, Arctic Express)

  • Solubility Enhancement Tags:

    • Express as a fusion with solubility tags (MBP, SUMO, Thioredoxin)

    • Include a cleavable linker between the tag and GA21628

    • Compare expression and solubility with different tag configurations

  • Buffer Optimization Strategy:

    • Screen buffers with varying pH ranges (6.0-9.0)

    • Test different salt concentrations (100-500 mM NaCl)

    • Include stabilizing additives (5-10% glycerol, 0.5-1 M urea, non-ionic detergents)

  • Refolding Protocol Development:

    • If inclusion bodies form, develop a denaturation and refolding protocol

    • Use gradual dialysis to remove denaturants

    • Employ chaperone co-expression systems to assist proper folding

This multifaceted approach has been shown to significantly increase the yield of soluble recombinant proteins in E. coli expression systems, with success rates improving from approximately 50% to over 80% for difficult-to-express proteins .

How can researchers address expression failure of recombinant UPF0389 protein GA21628?

When expression attempts for UPF0389 protein GA21628 fail completely, a systematic troubleshooting approach should be implemented:

  • Construct Verification Methodology:

    • Verify the sequence of the expression construct

    • Ensure the reading frame is correct and there are no premature stop codons

    • Confirm the integrity of promoter and regulatory elements

  • Host Compatibility Assessment:

    • Test multiple E. coli strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Consider rare codon analysis and use strains supplemented with rare tRNAs

    • Evaluate potential toxicity by monitoring growth curves pre- and post-induction

  • Alternative Expression Systems:

    • Try insect cell expression (Sf9, Hi5) using baculovirus vectors

    • Test yeast expression systems (Pichia pastoris, Saccharomyces cerevisiae)

    • Consider cell-free protein synthesis systems

  • mRNA Level Analysis:

    • Perform RT-PCR to confirm transcript presence

    • Use qPCR to quantify mRNA levels

    • Modify the 5' UTR to optimize ribosome binding site accessibility

Studies have shown that approximately 50% of recombinant proteins fail to be expressed in various host cells . For UPF0389 protein GA21628, special attention should be paid to the accessibility of translation initiation sites, as this has been demonstrated to be a critical factor in expression success for diverse proteins from various species .

What approaches can resolve protein degradation issues with recombinant UPF0389 protein GA21628?

When facing degradation of recombinant UPF0389 protein GA21628, implement the following methodological strategy:

  • Protease Inhibition Protocol:

    • Use a comprehensive protease inhibitor cocktail during purification

    • Test specific inhibitors (PMSF, EDTA, benzamidine) to identify effective combinations

    • Perform purification at 4°C to reduce proteolytic activity

  • Host Strain Selection:

    • Use protease-deficient E. coli strains (e.g., BL21 lacks lon and ompT proteases)

    • Consider clp-deficient strains for cytoplasmic expression

    • Test strains with altered redox environments for disulfide-containing proteins

  • Buffer Optimization:

    • Include stabilizing agents (glycerol, sucrose, arginine, proline)

    • Optimize pH to move away from the optimal range for proteases

    • Add reducing agents if oxidation may be triggering degradation

  • Expression Strategy Modifications:

    • Adjust induction time to coincide with lower endogenous protease activity

    • Reduce expression temperature to slow degradation processes

    • Consider periplasmic expression for appropriate proteins

Implementing these strategies has been shown to substantially reduce protein degradation during expression and purification, often yielding intact protein at purities >90% as determined by SDS-PAGE .

How might comparative genomics approaches advance our understanding of UPF0389 protein GA21628 function?

Comparative genomics offers powerful approaches to elucidate the function of poorly characterized proteins like UPF0389 protein GA21628:

  • Evolutionary Conservation Analysis:

    • Compare GA21628 homologs across Drosophila species and beyond

    • Identify conserved domains that may indicate functional importance

    • Calculate evolutionary rates to identify constrained regions

  • Genomic Context Examination:

    • Analyze adjacent genes and conserved gene neighborhoods

    • Study co-evolution patterns with functionally related genes

    • Examine synteny conservation across species

  • Functional Prediction Methodology:

    • Implement computational approaches like gene co-expression analysis

    • Use protein-protein interaction network predictions

    • Perform pathway enrichment analysis for genes with similar evolutionary profiles

This approach leverages the extensive genomic data available for Drosophila species, including the sequenced genome of D. pseudoobscura . The comparative genomics approach has been particularly valuable in Drosophila research, where it has been used to study genetic divergence between closely related species and subspecies, including D. p. pseudoobscura and D. p. bogotana .

What novel experimental approaches could uncover the molecular function of UPF0389 protein GA21628?

To decipher the molecular function of UPF0389 protein GA21628, consider implementing these cutting-edge methodological approaches:

  • CRISPR/Cas9 Gene Editing Strategy:

    • Generate precise knockouts in D. pseudoobscura

    • Create tagged versions for in vivo localization

    • Engineer domain-specific mutations to test structural hypotheses

  • Proximity Labeling Techniques:

    • Express GA21628 fused to BioID or APEX2 enzymes

    • Identify proximal proteins through biotinylation

    • Map the protein's interaction neighborhood in vivo

  • Cryo-EM and Integrative Structural Biology:

    • Determine high-resolution structure using cryo-electron microscopy

    • Combine with crosslinking mass spectrometry (XL-MS) for interaction data

    • Integrate computational modeling with experimental constraints

  • Single-Cell Transcriptomics:

    • Analyze expression patterns at single-cell resolution

    • Identify correlated gene expression patterns

    • Map developmental or tissue-specific expression dynamics

These approaches represent the frontier of protein function determination and have been successfully applied to characterize previously uncharacterized proteins in model organisms. For UPF0389 protein GA21628, these methods could provide unprecedented insights into its molecular role in Drosophila biology.

How might UPF0389 protein GA21628 studies contribute to broader questions in evolutionary biology?

Research on UPF0389 protein GA21628 can address fundamental questions in evolutionary biology:

  • Speciation Mechanisms Investigation:

    • Compare expression and function between closely related Drosophila species

    • Test for contribution to reproductive isolation mechanisms

    • Examine role in genomic conflicts or genetic incompatibilities

  • Adaptation and Selection Studies:

    • Analyze sequence variation in natural populations

    • Correlate genetic variants with environmental factors

    • Perform experimental evolution studies under controlled conditions

  • Evolutionary Systems Biology Approach:

    • Map GA21628 within protein interaction networks

    • Study network evolution and rewiring across species

    • Investigate how changes in one component affect entire biological systems

This research would build on the extensive history of Drosophila pseudoobscura as a model for studying natural selection and population genetics . Previous studies have demonstrated that D. pseudoobscura can evolve reproductive isolation after only eight generations when exposed to different environmental conditions (different food types) , making this an excellent system for studying the genetic basis of adaptation and speciation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.