Recombinant Drosophila sechellia Adenosine monophosphate-protein transferase FICD homolog (GM18629)

What is the structural characterization of Recombinant Drosophila sechellia Adenosine monophosphate-protein transferase FICD homolog?

The Recombinant Drosophila sechellia Adenosine monophosphate-protein transferase FICD homolog (GM18629) is a full-length protein consisting of 492 amino acids (1-492aa) . Its UniProt ID is B4I1V5, and it is also known by the synonyms "Protein adenylyltransferase Fic" and "De-AMPylase Fic" . The protein has a complete amino acid sequence beginning with MCTEAEQPSPPAQQQEQGNPPLCK and ending with LEFYESGSGDIP . In recombinant form, it is typically fused to an N-terminal His tag and expressed in E. coli expression systems to maintain biological activity while facilitating purification .

What are the optimal storage conditions for maintaining FICD homolog stability?

For optimal stability of the Recombinant Drosophila sechellia FICD homolog, storage conditions should be carefully controlled based on the protein's form. For the lyophilized form, storage at -20°C/-80°C maintains stability for up to 12 months . The reconstituted liquid form has a shorter shelf life of approximately 6 months when stored at -20°C/-80°C . Importantly, repeated freeze-thaw cycles should be strictly avoided as they significantly degrade protein integrity . For short-term use, working aliquots can be stored at 4°C for up to one week without significant loss of activity . When aliquoting for long-term storage, addition of 5-50% glycerol (with 50% being the standard recommendation) serves as a cryoprotectant to maintain protein stability during freezing .

What is the recommended reconstitution protocol for lyophilized FICD homolog?

The optimal reconstitution protocol for lyophilized Drosophila sechellia FICD homolog requires several precise steps to ensure maximum recovery of functional protein. First, briefly centrifuge the vial containing lyophilized protein to ensure all material settles at the bottom before opening . Reconstitute the protein using deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL . For long-term storage preparations, add glycerol to a final concentration of 5-50% (with 50% being the standard industry recommendation) to prevent freeze damage during storage . The reconstitution buffer is typically Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain protein stability and solubility . After reconstitution, the solution should be gently mixed rather than vortexed to prevent protein denaturation, and aliquoted immediately to avoid repeated freeze-thaw cycles .

How can researchers verify the purity and functionality of recombinant FICD homolog in experimental setups?

Researchers can employ multiple complementary methods to verify both purity and functionality of recombinant FICD homolog. For purity assessment, SDS-PAGE analysis should be performed to confirm the expected molecular weight and to verify the manufacturer's purity claim of >85% or >90% as stated in product specifications . Western blotting using anti-His antibodies can further confirm the identity of the His-tagged protein. For functionality verification, researchers should conduct an enzymatic activity assay specific to adenosine monophosphate-protein transferase activity, measuring the protein's ability to transfer AMP to substrate proteins. The enzyme has an EC classification number of 2.7.7.n1, indicating its specific catalytic role . Additional verification can include mass spectrometry analysis to confirm the full amino acid sequence against the provided sequence: MCTEAEQPSPPAQQQEQGNPPLCKAQNPKPARLYRLVLLFVAGSLAAWTFHALSSTNLVWKLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALG ALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQALTISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHSSTLHPVNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSIEFYESGSGDIP .

What are the considerations for optimizing transfection efficiency when expressing FICD homolog in insect cell systems?

When optimizing transfection efficiency for FICD homolog expression in insect cell systems, researchers must consider several critical parameters. While the commercial recombinant protein is expressed in E. coli, insect cell expression may provide more native post-translational modifications . First, select an appropriate insect cell line (typically Sf9 or High Five) based on the protein's complexity and modification requirements. The timing of harvest is crucial - generally 48-72 hours post-infection provides optimal balance between yield and quality. For transfection, use a baculovirus expression vector containing the full 492-amino acid sequence of the FICD homolog with appropriate signal sequences to ensure proper localization . Optimize the MOI (multiplicity of infection) through titration experiments, typically starting with MOIs between 1-5 and adjusting based on expression levels. Temperature should be maintained at 27-28°C during expression, as higher temperatures can lead to protein degradation. After expression, purification should leverage the His-tag using immobilized metal affinity chromatography (IMAC), carefully optimizing imidazole concentrations in wash and elution buffers to maintain the >90% purity level achieved in commercial preparations .

How should researchers design experimental controls when studying FICD homolog in comparative Drosophila species studies?

When designing experimental controls for comparative Drosophila species studies involving FICD homolog, researchers should implement a multi-layered control strategy. First, include phylogenetically related Drosophila species in your experimental design, particularly D. melanogaster, D. simulans, and D. mauritiana alongside D. sechellia, as these species show documented differences in their adaptation to toxic environments . Second, perform parallel experiments with both wild-type and genetically modified variants lacking functional FICD homolog to establish baseline activities and phenotypes. Third, include time-matched controls for all experimental conditions to account for any temporal variations in protein activity or stability. Fourth, employ negative controls consisting of enzymatically inactive mutants of the FICD homolog (typically created by site-directed mutagenesis of catalytic residues) to distinguish between enzymatic and structural roles of the protein. Fifth, include purified recombinant protein from E. coli alongside native protein extracted from Drosophila tissues to control for potential differences in post-translational modifications or folding. This comprehensive control strategy ensures robust interpretation of experimental results within the broader context of Drosophila evolutionary biology and the specific adaptation of D. sechellia to toxic environments .

How can researchers leverage FICD homolog to investigate evolutionary adaptations in Drosophila sechellia?

Researchers can employ multiple sophisticated approaches to investigate evolutionary adaptations using FICD homolog. D. sechellia provides a unique model for studying ecological specialization, as it has evolved resistance to toxic compounds like octanoic acid found in Morinda citrifolia fruits . To leverage FICD homolog in this context, researchers should first conduct comparative sequence analysis across Drosophila species (D. melanogaster, D. simulans, D. mauritiana, and D. sechellia) to identify evolutionary signatures in the protein sequence, paying particular attention to synonymous versus non-synonymous substitutions that may indicate selective pressure . Next, perform functional complementation experiments by expressing the D. sechellia FICD homolog in sensitive Drosophila species to determine if the protein confers increased resistance to toxins. Resistance assays should quantify survival rates at various octanoic acid concentrations (0.5% to 1.2%) using standardized exposure protocols . Researchers should also investigate potential regulatory adaptations through qRT-PCR to measure expression level differences across species, as adaptation may occur through changes in expression rather than protein sequence . Finally, conduct protein-protein interaction studies to identify toxin-related molecular pathways that may be modified by FICD homolog activity, potentially revealing novel mechanisms of detoxification or stress resistance specific to D. sechellia's ecological niche.

What are the methodological approaches for investigating the substrate specificity of FICD homolog in AMPylation reactions?

Investigating substrate specificity of FICD homolog requires a comprehensive methodological approach combining biochemical, proteomics, and structural biology techniques. First, researchers should perform in vitro AMPylation assays using purified recombinant FICD homolog (>90% purity by SDS-PAGE) with candidate substrate proteins, incorporating radioactively labeled ATP (typically [α-32P]-ATP) or using click chemistry with azido-ATP analogs to track AMPylation events . Next, conduct mass spectrometry-based proteomics after in vitro or in vivo AMPylation reactions to identify modification sites with high precision. For high-throughput substrate identification, employ protein microarrays incubated with active FICD homolog and detection systems for AMPylation. To understand structural determinants of specificity, perform computational modeling based on the 492-amino acid sequence, focusing on the catalytic domain and potential substrate-binding regions . Additionally, create targeted mutations in the enzyme's active site or substrate recognition domains to systematically map the molecular determinants of specificity. For validation in biological contexts, develop antibodies against AMPylated peptides to detect modification in vivo or use proximity labeling approaches (BioID or APEX) fused to FICD homolog to identify proteins in close proximity within cellular environments. This integrated approach will establish both the range of substrates and the specific recognition mechanisms employed by the FICD homolog.

How can researchers design experiments to elucidate the role of FICD homolog in stress response pathways?

Designing experiments to elucidate the role of FICD homolog in stress response pathways requires a multi-faceted approach spanning from molecular to organismal levels. Initially, researchers should perform stress induction experiments exposing D. sechellia to various stressors (oxidative, thermal, chemical) while monitoring FICD homolog expression through qRT-PCR and Western blotting to establish correlation between stress conditions and protein levels . Next, implement CRISPR-Cas9 gene editing to create FICD knockout and overexpression D. sechellia lines, followed by comprehensive phenotypic analysis under stress conditions compared to wild-type flies. For mechanistic insights, conduct phosphoproteomics and interactome studies before and after stress induction to identify stress-dependent interactions and modifications involving FICD. Utilizing the recombinant protein with >90% purity, perform in vitro AMPylation assays with candidate stress response proteins to identify direct substrates . To understand pathway integration, combine genetic approaches with pharmacological inhibition of known stress response pathways to map epistatic relationships. Tissue-specific conditional knockdown experiments using RNAi with tissue-specific promoters will reveal tissue-dependent roles in stress protection. Finally, comparative studies across Drosophila species with different stress tolerances (particularly focusing on D. sechellia's unique adaptation to octanoic acid) will provide evolutionary context for FICD's role in specialized stress response mechanisms . This comprehensive experimental design will elucidate both the molecular mechanisms and biological significance of FICD in stress response pathways.

What are the critical quality control parameters for maintaining reproducibility when working with recombinant FICD homolog?

Maintaining reproducibility when working with recombinant FICD homolog requires rigorous quality control across several critical parameters. First, implement batch consistency verification through SDS-PAGE and Western blotting to confirm protein integrity and molecular weight, ensuring the purity meets or exceeds the stated >85-90% threshold . Second, perform activity assays before each experimental series to verify enzymatic function, establishing standardized activity units that can normalize experimental inputs across different protein preparations. Third, strictly adhere to storage protocols including aliquoting to avoid freeze-thaw cycles, maintaining storage at -20°C/-80°C for long-term stability, and using working aliquots at 4°C for no more than one week . Fourth, standardize reconstitution procedures using deionized sterile water to concentrations between 0.1-1.0 mg/mL, with glycerol addition to final concentrations of 5-50% for cryoprotection . Fifth, ensure buffer consistency for all experiments, using the recommended Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Sixth, implement detailed record-keeping of source material, lot numbers, preparation dates, storage conditions, and thaw history. Seventh, perform regular stability tests on stored aliquots to detect potential degradation over time. These comprehensive quality control measures collectively ensure experimental reproducibility when working with this sensitive recombinant protein.

What strategies can researchers employ to optimize protein yield and solubility during recombinant FICD homolog production?

Optimizing protein yield and solubility during recombinant FICD homolog production requires strategic adjustments across multiple parameters of the expression system. While commercial preparations utilize E. coli expression systems, researchers can implement several optimization strategies . First, select appropriate E. coli strains such as BL21(DE3), Rosetta, or Arctic Express based on codon usage and folding requirements. Next, optimize expression vectors to include solubility-enhancing fusion partners beyond the standard His-tag, such as SUMO, MBP, or GST tags that can be later removed with specific proteases if necessary. Temperature modulation during induction is critical—lowering induction temperature to 16-18°C often improves solubility by slowing protein synthesis and allowing proper folding. Optimize induction conditions through factorial experiments varying IPTG concentration (typically 0.1-1.0 mM), induction time (4-24 hours), and cell density at induction (OD600 of 0.6-1.0). Buffer optimization should include screening various pH ranges (7.0-8.5) and adding solubility enhancers such as trehalose (standard 6%) or low concentrations of non-ionic detergents . Addition of specific cofactors or substrates during lysis can stabilize protein structure and improve solubility. Implement a systematic lysis procedure optimization, testing sonication parameters, pressure-based disruption, or enzymatic lysis to minimize protein aggregation during extraction. Finally, develop a multi-step purification strategy beyond basic IMAC to achieve the >90% purity level seen in commercial preparations while maximizing yield .

How can researchers develop specific antibodies against FICD homolog for immunological detection in tissue samples?

Developing specific antibodies against FICD homolog for immunological detection requires a systematic approach spanning epitope selection to validation. First, perform in silico epitope prediction analysis on the 492-amino acid sequence to identify immunogenic regions with high surface probability and low sequence conservation across related proteins . Select 2-3 candidate epitopes, preferably from different regions of the protein, and synthesize corresponding peptides for immunization. When selecting host species, consider using rabbits for polyclonal production or mice/rats for monoclonal development, ensuring the chosen epitopes have low homology to host proteins. Immunize with the purified recombinant protein (>90% purity) conjugated to a carrier protein like KLH if using synthetic peptides . For polyclonal antibody production, implement an optimized immunization schedule with regular booster injections over 8-12 weeks, followed by affinity purification against the recombinant protein. For monoclonal antibody production, perform hybridoma screening with multiple rounds of selection to identify clones with highest specificity and sensitivity. Validation must be rigorous, including Western blotting against recombinant protein and D. sechellia tissue lysates, with knockout/knockdown samples as negative controls . Additional validation should include immunoprecipitation to confirm specificity, immunohistochemistry with appropriate controls to verify tissue localization patterns, and cross-reactivity testing against related Drosophila species proteins to ensure specificity . This comprehensive approach will yield antibodies suitable for diverse immunological applications in FICD homolog research.

How can FICD homolog be utilized to study evolutionary differences in protein function across Drosophila species?

FICD homolog offers a powerful model for studying evolutionary differences in protein function across Drosophila species through multiple complementary approaches. First, conduct comparative sequence analysis of FICD homologs from D. sechellia, D. melanogaster, D. simulans, and D. mauritiana to identify amino acid variations that may influence function, with particular focus on catalytic domains and regulatory regions . Next, perform heterologous expression experiments expressing each species' FICD variant in a common cellular background to directly compare enzymatic activities and substrate preferences under identical conditions. Develop chimeric proteins swapping domains between species variants to map functional differences to specific protein regions. Conduct in vitro evolution experiments exposing different species' FICD variants to selective pressures to observe convergent or divergent adaptation patterns. Implement advanced structural biology approaches including crystallography or cryo-EM to resolve structural differences between species variants that may explain functional divergence. Assess differential regulation through promoter analysis and expression studies across species in response to various environmental conditions, particularly focusing on D. sechellia's unique adaptation to octanoic acid toxicity . Finally, conduct comparative interactomics to identify species-specific protein interaction networks. This research framework leverages the unique evolutionary history of Drosophila species, particularly D. sechellia's adaptation to toxic environments, to understand how protein function evolves in response to ecological specialization .

What protocols should be employed for comparative functional assays of FICD homolog across different Drosophila species?

For robust comparative functional assays of FICD homolog across Drosophila species, researchers should implement standardized protocols addressing multiple aspects of protein function. First, develop species-matched expression systems by cloning the FICD homolog genes from D. sechellia, D. melanogaster, D. simulans, and D. mauritiana with identical purification tags, preferably the N-terminal His tag used in commercial preparations . Express all variants under identical conditions in E. coli, and purify to >90% homogeneity using standardized IMAC protocols for direct comparability . For enzymatic activity assays, establish a quantitative AMPylation assay using either radioactive [α-32P]-ATP incorporation or chemical biology approaches with clickable ATP analogs, testing each species variant against a standardized panel of potential substrates. Determine enzyme kinetics (Km, Vmax, kcat) for each species variant under identical conditions (pH, temperature, ionic strength). Perform thermal stability assays (differential scanning fluorimetry) to compare structural robustness across species variants. For in vivo functional comparisons, develop transgenic fly lines expressing each species' FICD variant in a common genetic background with equivalent expression levels. Challenge these transgenic lines with octanoic acid resistance assays at concentrations from 0.5% to 1.2% using standardized exposure protocols and mortality assessments . This comprehensive protocol suite enables direct functional comparison across species, illuminating how evolutionary forces have shaped FICD function in different ecological contexts, particularly D. sechellia's specialization to toxic host plants .