Recombinant Drosophila sechellia ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized in E. coli with an N-terminal His tag for affinity purification .

ParameterSpecification
Expression SystemEscherichia coli
TagHis tag (N-terminal)
Purity>90% (verified by SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL), with optional glycerol (5–50%)
Storage-20°C/-80°C (long-term); 4°C (working aliquots, ≤1 week)

ATP Synthase Activity

Studies on Drosophila ATP synthase mutants reveal:

  • Reduced ATPase Activity: Mutations in ATP6 lower mitochondrial ATP synthase activity by up to sixfold, correlating with developmental defects .

  • Cristae Abnormalities: Electron tomography shows disorganized inner mitochondrial membranes, highlighting ATP6’s role in maintaining cristae architecture .

Experimental Uses

  • ELISA and Immunoassays: Utilized as an antigen for antibody development .

  • Functional Studies: Reconstituted into liposomes or mitochondrial preparations to probe proton translocation and ATP synthesis mechanisms .

  • Disease Modeling: Enables comparative studies of ATP6-related pathologies (e.g., neurodegeneration) in Drosophila .

Comparative Analysis with Human Orthologs

While Drosophila ATP6 shares functional homology with human MT-ATP6, pathogenic mutations in humans (e.g., T8993G) manifest as severe encephalopathies, whereas fruit fly models exhibit progressive myodegeneration and locomotor deficits . This divergence underscores species-specific metabolic demands.

Limitations and Future Directions

Current research gaps include:

  • Structural Data: High-resolution structures of Drosophila ATP synthase remain limited compared to yeast and human counterparts .

  • Extracellular Roles: The bifunctionality of ATP6 (e.g., potential signaling roles akin to Drosophila Sun protein) warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila sechellia (Fruit fly)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSAIFNLSLNWLSTFLGILMIPSIYWLMPSRYNIVWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMMYGWIN HTQHMFAHLVPQGTPAVLMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGP SMSYLLVTFLLTAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links

KEGG: dse:ATP6

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of mt:ATPase6 in Drosophila sechellia?

Mt:ATPase6 in Drosophila sechellia functions as a key component of the mitochondrial ATP synthase complex (Complex V), specifically within the membrane-embedded F0 domain. This protein contributes to the proton channel that enables the translocation of protons across the inner mitochondrial membrane. The proton gradient generated by electron transport complexes drives ATP synthesis through a rotary mechanism coupled to the catalytic domain (F1) . In Drosophila, the ATP synthase complex plays a critical role in energy metabolism, particularly during high-energy demanding processes such as early embryonic development and flight muscle function .

How does mt:ATPase6 structure relate to its function in proton translocation?

Mt:ATPase6 contains transmembrane helices that form part of the proton channel within the F0 domain of ATP synthase. These helices include specifically positioned amino acid residues that facilitate proton movement across the membrane. The protein's structure allows it to participate directly in proton translocation, which is coupled to the rotary mechanism of ATP synthesis in the F1 domain . Research in Drosophila models suggests that mutations affecting critical residues in the transmembrane regions can significantly impair proton movement and consequently ATP production, highlighting the structure-function relationship of this protein .

What are the known genetic and protein sequence differences between D. sechellia mt:ATPase6 and other Drosophila species?

D. sechellia mt:ATPase6 shows evolutionary conservation with other Drosophila species while maintaining species-specific variations. Comparative sequence analysis reveals approximately 95-98% sequence identity with D. melanogaster mt:ATPase6, with most variations occurring in non-catalytic regions. The most conserved regions include the transmembrane domains and residues directly involved in proton translocation. These variations may contribute to the ecological adaptation of D. sechellia to its specific host plant environment. Methodologically, researchers should use multiple sequence alignment tools such as MUSCLE or Clustal Omega to identify these variations, followed by homology modeling to predict the functional consequences of these differences.

What are the optimal expression systems for producing recombinant D. sechellia mt:ATPase6?

For recombinant D. sechellia mt:ATPase6 expression, bacterial systems like E. coli often prove challenging due to the hydrophobic nature of this mitochondrial membrane protein. Instead, researchers should consider:

  • Baculovirus-insect cell systems (Sf9 or High Five cells): These provide proper folding machinery and post-translational modifications.

  • Yeast expression systems (S. cerevisiae or P. pastoris): Particularly useful as they have similar mitochondrial machinery.

Methodology requires codon optimization for the host system, inclusion of affinity tags (preferably C-terminal to avoid interference with mitochondrial targeting sequences), and careful selection of detergents for extraction and purification. Optimal results typically come from using a modified pFastBac vector for insect cell expression, with expression yields of approximately 1-2 mg/L culture. Purification should employ a combination of metal affinity chromatography followed by size exclusion chromatography in the presence of stabilizing lipids or detergents .

How can I effectively design mutations in recombinant D. sechellia mt:ATPase6 for structure-function studies?

Effective mutation design for D. sechellia mt:ATPase6 structure-function studies should follow these methodological steps:

  • Identify conserved residues through multiple sequence alignment across Drosophila species and broader phylogenetic comparisons.

  • Target residues in predicted functional domains using homology modeling against crystallized ATP synthase structures.

  • Employ site-directed mutagenesis using overlap extension PCR with high-fidelity polymerases.

  • Consider both conservative and non-conservative substitutions to distinguish between structural and functional roles.

  • Create cysteine-free variants first if planning subsequent cysteine scanning mutagenesis for accessibility studies.

Particularly important targets include the conserved arginine residues in transmembrane helices that participate in proton translocation, charged residues at subunit interfaces, and residues showing species-specific variations. Validation of mutant phenotypes should include both in vitro ATP synthase activity assays and in vivo functional complementation studies in Drosophila models with deficient endogenous mt:ATPase6 .

What is the most reliable method for measuring ATP synthase activity in recombinant D. sechellia mt:ATPase6 systems?

The most reliable method for measuring ATP synthase activity in recombinant D. sechellia mt:ATPase6 systems involves a combination of biochemical assays:

  • ATPase activity assay: Measure ATP hydrolysis using the azide-sensitive ATPase activity approach. This involves quantifying released inorganic phosphate in the presence and absence of sodium azide (a specific inhibitor of mitochondrial ATP synthase). The difference represents specific ATP synthase activity. A typical wild-type preparation should show approximately 40-50% azide-sensitive activity .

  • ATP synthesis assay: Monitor ATP production using reconstituted proteoliposomes with an artificially induced proton gradient. Use luciferase-based ATP detection systems for real-time quantification.

  • Proton translocation assay: Measure proton movement using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine).

Assay TypeSensitivityAdvantagesLimitations
ATPase activity5-10 nmol Pi/min/mgSimple, robustIndirect measure of synthesis
ATP synthesis2-5 nmol ATP/min/mgDirect functional measureComplex reconstitution required
Proton translocationN/A (fluorescence units)Directly measures proton movementQualitative rather than quantitative

For all assays, proper controls including known inhibitors (oligomycin, DCCD) are essential for validation .

How does D. sechellia mt:ATPase6 contribute to mitochondrial membrane organization?

D. sechellia mt:ATPase6 contributes to mitochondrial membrane organization primarily through its role in ATP synthase dimerization and subsequent cristae formation. The protein mediates interactions between adjacent ATP synthase monomers, facilitating the formation of ATP synthase dimers that localize preferentially at the highly curved edges of cristae. This arrangement helps maintain proper cristae morphology, which is essential for efficient oxidative phosphorylation and compartmentalization of the electron transport chain components .

Methodologically, researchers can investigate this function through:

  • Cryo-electron microscopy of isolated mitochondria from wild-type and mt:ATPase6-deficient D. sechellia.

  • Blue native PAGE analysis to assess the formation of ATP synthase dimers and oligomers.

  • Fluorescence recovery after photobleaching (FRAP) with tagged mt:ATPase6 to analyze protein mobility within the membrane.

Studies in related Drosophila species demonstrate that mutations in ATP synthase components, including the ε-subunit, can lead to abnormal cristae morphology and reduced oligomerization of ATP synthase complexes, suggesting similar roles for the a-subunit .

What is the relationship between D. sechellia mt:ATPase6 function and embryonic development?

D. sechellia mt:ATPase6 plays a critical role in embryonic development through ATP production necessary for energy-intensive developmental processes. Based on studies in related Drosophila species, mt:ATPase6 dysfunction significantly impacts:

  • Cortical divisions during syncytial blastoderm formation, where decreased ATP levels selectively affect cytoskeletal organization and molecular motor function.

  • Cellular movements during gastrulation, which require substantial energy for coordinated morphogenesis.

Methodologically, researchers can investigate this relationship through:

  • Live imaging of wild-type and mt:ATPase6-mutant embryos using fluorescently labeled cytoskeletal markers.

  • ATP measurements in specific embryonic regions using luciferase-based ATP biosensors.

  • Analysis of molecular motor dynamics in the context of reduced ATP levels.

Research in Drosophila with mutations in ATP synthase components shows that even partial reduction in ATP synthase activity (e.g., sixfold reduction) can cause specific defects in nuclear spacing, spindle organization, and actin-based structures during embryonic development .

How does temperature affect the activity and stability of recombinant D. sechellia mt:ATPase6?

Temperature significantly influences both the activity and stability of recombinant D. sechellia mt:ATPase6, with implications for experimental design and ecological adaptation. Methodologically, temperature effects should be examined through:

  • Thermal stability assays using differential scanning calorimetry or thermal shift assays with fluorescent dyes.

  • Activity measurements across a temperature gradient (15-40°C) using ATP synthesis or hydrolysis assays.

  • Protein unfolding kinetics monitored by circular dichroism spectroscopy.

Findings from studies with Drosophila ATP synthase components indicate that:

  • Activity typically increases with temperature until reaching an optimum (usually 30-35°C for D. sechellia), followed by rapid decline due to protein denaturation.

  • ATP synthase mutants often show increased temperature sensitivity, with phenotypes becoming more severe at higher temperatures where ATP requirements increase .

  • Temperature adaptation in D. sechellia may involve specific amino acid substitutions that modify thermal stability while preserving catalytic function.

These temperature-dependent characteristics have ecological relevance as D. sechellia has adapted to specific microhabitats on the Seychelles islands.

What are the key evolutionary adaptations in D. sechellia mt:ATPase6 compared to other Drosophila species?

D. sechellia mt:ATPase6 displays several evolutionary adaptations compared to other Drosophila species, reflecting its specialized ecological niche as an obligate specialist on Morinda citrifolia fruit. Key adaptations include:

  • Amino acid substitutions in less conserved regions that may fine-tune ATP synthase efficiency under the specific metabolic demands of utilizing M. citrifolia as a resource.

  • Potential modifications in proton-sensing residues that could adapt the ATP synthase to the specific pH conditions encountered in its host plant environment.

  • Coevolution with other mitochondrially encoded subunits to maintain optimal protein-protein interactions within the ATP synthase complex.

Methodologically, researchers should investigate these adaptations through:

  • Selection analysis (dN/dS ratios) across the mt:ATPase6 sequence in different Drosophila species.

  • Ancestral sequence reconstruction to identify the timing and context of adaptive substitutions.

  • Functional complementation experiments to test the effects of species-specific residues.

These adaptations likely contribute to D. sechellia's unique ability to tolerate the toxic compounds found in M. citrifolia fruits, possibly through modified energy metabolism pathways .

How do mutations in D. sechellia mt:ATPase6 affect fitness in different environmental conditions?

Mutations in D. sechellia mt:ATPase6 affect fitness differently across environmental conditions, revealing important genotype-environment interactions. Methodologically, fitness effects should be assessed through:

  • Comparative growth rate measurements across temperature ranges (18-30°C).

  • Developmental timing analyses in different nutritional conditions.

  • Competitive fitness assays against wild-type strains.

  • Metabolic rate measurements using respirometry.

Research on ATP synthase mutations in Drosophila indicates that:

  • Mutations reducing ATP synthase efficiency typically show stronger negative fitness effects at higher temperatures where metabolic demands increase.

  • Environmental stressors (oxidative stress, toxins) often exacerbate the fitness costs of mt:ATPase6 mutations.

  • Some mutations may provide conditional benefits under specific environmental conditions, potentially explaining the maintenance of genetic variation in natural populations.

These fitness effects have ecological relevance for understanding D. sechellia's specialization on M. citrifolia and its limited geographical distribution in the Seychelles archipelago .

How can D. sechellia mt:ATPase6 studies inform human mitochondrial disease research?

D. sechellia mt:ATPase6 studies provide valuable insights for human mitochondrial disease research through comparative functional analysis. Methodologically, researchers can:

  • Create transgenic Drosophila models carrying human disease-associated mt:ATPase6 mutations (like those causing NARP syndrome or Leigh syndrome).

  • Conduct cross-species rescue experiments to test functional conservation.

  • Perform high-throughput drug screens using Drosophila models with mt:ATPase6 mutations.

Research indicates that many pathogenic human MT-ATP6 mutations affect conserved residues with similar functional consequences across species. For example, studies in Drosophila ATP synthase components show that reduced ATP synthase activity leads to specific neurological and developmental phenotypes that parallel human mitochondrial disorders . Therapeutic compounds identified in Drosophila models could represent candidates for treating human mitochondrial diseases, particularly those targeting common mechanisms like oxidative stress or mitochondrial dynamics.

What are the molecular mechanisms underlying neurodegeneration in mt:ATPase6 mutants?

Neurodegeneration in mt:ATPase6 mutants involves multiple interconnected molecular mechanisms that can be studied in D. sechellia models. Methodologically, researchers should examine:

  • Bioenergetic dysfunction: Measure ATP levels, membrane potential, and oxygen consumption in isolated neuronal mitochondria.

  • Oxidative stress: Quantify ROS production using fluorescent indicators and measure oxidative damage markers.

  • Calcium homeostasis disruption: Monitor calcium dynamics with calcium-sensitive fluorescent probes.

  • Mitochondrial dynamics alterations: Analyze mitochondrial morphology, fusion/fission events, and mitophagy.

Research in ATP synthase-deficient models demonstrates that neurons are particularly vulnerable to ATP deficiency due to their high energy demands and limited glycolytic capacity. The progression typically begins with decreased ATP production, leading to compensatory mitochondrial proliferation, increased ROS generation, calcium dysregulation, and ultimately neuronal death . Molecular imaging techniques can visualize these processes in vivo using transgenic Drosophila with fluorescent reporters expressed in specific neuronal populations.

How can CRISPR-Cas9 technology be optimized for editing mt:ATPase6 in D. sechellia?

Optimizing CRISPR-Cas9 for editing mitochondrial DNA, particularly mt:ATPase6 in D. sechellia, requires specialized approaches due to the unique challenges of mitochondrial genome editing. Methodological recommendations include:

  • Use mitoTALENs or base editors with mitochondrial targeting sequences rather than standard CRISPR-Cas9, as conventional Cas9 lacks efficient mitochondrial import.

  • Design highly specific guide RNAs with minimal off-target effects in both nuclear and mitochondrial genomes.

  • Employ selection strategies based on mitochondrial function rather than standard antibiotic resistance markers.

  • Consider heteroplasmy management strategies, including selectable markers that can drive desired mitochondrial genotypes to homoplasmy.

Optimal protocols typically achieve 5-15% initial editing efficiency, which can be enriched through subsequent selection. Successful editing should be verified through a combination of sequencing, restriction fragment length polymorphism analysis, and functional assays of ATP synthase activity .

What are the latest techniques for studying the real-time dynamics of ATP synthase in living D. sechellia cells?

Cutting-edge techniques for studying real-time ATP synthase dynamics in living D. sechellia cells include:

  • FRET-based ATP sensors: Genetically encoded fluorescent biosensors that allow spatiotemporal monitoring of ATP levels with subcellular resolution.

  • Super-resolution microscopy (STED, PALM, STORM): These techniques overcome the diffraction limit to visualize individual ATP synthase complexes and their organization within mitochondrial cristae.

  • Single-particle tracking: Using photoactivatable or photoconvertible fluorescent proteins fused to mt:ATPase6 to track protein movement and interactions.

  • Correlative light and electron microscopy (CLEM): Combining the molecular specificity of fluorescence with the ultrastructural detail of electron microscopy.

These approaches can reveal dynamic aspects of ATP synthase function, including conformational changes during catalysis, oligomerization states, and responses to cellular energy demands. Implementation requires careful genetic engineering to introduce fluorescent tags without disrupting protein function, optimization of imaging parameters, and sophisticated image analysis algorithms for quantification .

How can systems biology approaches integrate mt:ATPase6 function with broader metabolic networks in D. sechellia?

Systems biology approaches can effectively integrate mt:ATPase6 function with broader metabolic networks in D. sechellia through:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and mt:ATPase6 mutant flies to identify affected pathways.

  • Flux balance analysis (FBA): Mathematical modeling of metabolic fluxes to predict the system-wide effects of altered ATP synthase function.

  • Metabolic control analysis: Determining the control coefficients of mt:ATPase6 on various metabolic pathways.

  • Network inference algorithms: Identifying regulatory relationships between mt:ATPase6 activity and other cellular processes.

These approaches reveal how mt:ATPase6 perturbations propagate through the metabolic network, affecting processes beyond energy production. For example, research on ATP synthase deficiency shows compensatory upregulation of glycolytic pathways, alterations in amino acid metabolism, and increased mitochondrial biogenesis as adaptive responses . Proper implementation requires comprehensive data collection across multiple biological levels, sophisticated computational modeling, and experimental validation of predicted network relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.