Recombinant Drosophila sechellia Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila sechellia Spastin

Recombinant Drosophila sechellia Spastin (spas) is a laboratory-produced version of the naturally occurring Spastin protein found in Drosophila sechellia fruit flies. While specific published data on D. sechellia Spastin is limited, valuable insights can be inferred from extensively studied homologs in related Drosophila species. Spastin belongs to the AAA (ATPases Associated with diverse cellular Activities) protein family and plays a crucial role in microtubule dynamics, particularly within the nervous system. The human homolog of this protein is encoded by the SPG4 gene, mutations in which cause the most prevalent form of autosomal dominant hereditary spastic paraplegia (AD-HSP), a neurodegenerative disorder characterized by progressive lower limb spasticity .

Protein Structure and Domains

Based on comparative analysis with related Drosophila species, D. sechellia Spastin likely contains several key structural domains:

  1. N-terminal region with a newly identified potential transmembrane domain, which has been confirmed in both Drosophila melanogaster and human Spastin proteins

  2. Central regulatory region with multiple phosphorylation sites

  3. C-terminal AAA ATPase domain responsible for its microtubule-severing activity

Expression Systems and Methodology

Recombinant D. sechellia Spastin would typically be produced using bacterial expression systems, similar to the methods employed for other Drosophila Spastin proteins. The recommended approach would involve:

  1. Cloning the D. sechellia spas gene into an appropriate expression vector

  2. Expressing the protein in E. coli with an N-terminal His-tag for purification purposes

  3. Inducing expression under optimized conditions

  4. Purifying the protein using affinity chromatography

This approach follows established protocols for D. melanogaster Spastin, which is expressed in E. coli with an N-terminal His-tag, resulting in a full-length protein covering amino acids 1-758 .

Physical and Chemical Properties

PropertySpecification
Molecular Weight~85 kDa (estimated based on homologs)
Protein Length~758 amino acids (estimated based on D. melanogaster)
TagN-terminal His-tag (recommended for purification)
FormLyophilized powder (typical for storage)
Purity>90% as determined by SDS-PAGE
ApplicationsSDS-PAGE, microtubule-severing assays, structural studies

Role in Microtubule Dynamics

Spastin proteins function as microtubule-severing enzymes that regulate cytoskeletal organization, particularly in neurons. Studies of D. melanogaster Spastin have revealed that:

  1. Overexpression of Spastin erases the muscle microtubule network, consistent with its microtubule-severing activity

  2. Loss-of-function mutations lead to fewer microtubule bundles within the neuromuscular junction (NMJ), especially in distal boutons

  3. This seemingly paradoxical reduction in microtubules in the absence of a severing protein suggests Spastin plays a complex role in maintaining organized microtubule arrays

Neurological Significance

Drosophila Spastin exhibits tissue-specific expression patterns that differ from its vertebrate counterparts. While vertebrate Spastin is ubiquitously expressed, Drosophila melanogaster Spastin expression becomes restricted primarily to the central nervous system during embryogenesis . This neuron-specific expression pattern suggests specialized functions in neural development and maintenance.

Studies with D. melanogaster Spastin mutants have demonstrated several neurological phenotypes:

  1. Morphological abnormalities in synaptic boutons at the neuromuscular junction (more numerous and clustered)

  2. Impaired neurotransmitter release at synapses

  3. Severe movement defects in adult flies, including inability to fly or jump, poor climbing ability, and shortened lifespans

  4. Milder phenotypes in hypomorphic mutants with partial function

These findings suggest that D. sechellia Spastin would likely play similar critical roles in maintaining neuronal integrity and function.

Comparative Table of Spastin Functions Across Species

FunctionD. melanogasterHumanD. sechellia (inferred)
Expression PatternCNS-specificUbiquitousLikely CNS-specific
Microtubule ActivitySevering enzymeSevering enzymeLikely severing enzyme
Loss-of-Function EffectsNMJ defects, motor problemsAxon degeneration, HSPLikely NMJ defects, motor problems
Neuronal RequirementCritical for synapse maintenanceCritical for long axon maintenanceLikely critical for synapse maintenance

Model for Neurodegenerative Disorders

Recombinant D. sechellia Spastin serves as a valuable research tool for investigating:

  1. The molecular mechanisms of hereditary spastic paraplegia

  2. Conservation of neurodegenerative disease pathways across species

  3. The role of microtubule dynamics in neuronal maintenance and degeneration

The glutamatergic synapses at the Drosophila NMJ resemble excitatory synapses in the mammalian spinal cord, making this an excellent model system for understanding how Spastin mutations affect human patients with AD-HSP .

Biochemical and Cellular Studies

Purified recombinant D. sechellia Spastin enables various experimental applications:

  1. In vitro microtubule-severing assays to assess enzymatic activity

  2. Structure-function analyses through site-directed mutagenesis

  3. Protein interaction studies to identify binding partners

  4. Reconstitution experiments in cellular systems

Drug Discovery Platform

Recombinant D. sechellia Spastin could facilitate:

  1. High-throughput screening for compounds that modulate microtubule-severing activity

  2. Development of potential therapeutic approaches for HSP

  3. Testing of neuroprotective strategies to preserve axonal integrity

Evolutionary Conservation Analysis

Comparative studies between D. sechellia Spastin and other Drosophila species Spastins would provide insights into:

  1. Evolutionary conservation of functional domains

  2. Species-specific adaptations in neural development

  3. Correlation between Spastin sequence variations and neural phenotypes

Structure-Function Relationship

Detailed structural analysis of recombinant D. sechellia Spastin could reveal:

  1. The precise mechanism of ATP hydrolysis driving microtubule severing

  2. How the N-terminal transmembrane domain influences protein localization and function

  3. The structural basis for protein-protein interactions that regulate activity

Therapeutic Applications

Further research using recombinant D. sechellia Spastin might lead to:

  1. Identification of small molecules that can rescue loss-of-function phenotypes

  2. Gene therapy approaches for HSP based on understanding of Spastin function

  3. Novel biomarkers for neurodegenerative disease progression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
spas; GM26551; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Drosophila sechellia (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSSTKSPIKSSSGAGSSGGGVGGRQSTHRSSSASNVAAVVAGGSSA AGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHSYGGYSSSVHKQNLYVVSF PIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPS ELNREGDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYI SKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSM ARDRLHFLALREQDLQMQRLSLKEKQKEEARSKPQKTREPMLAGMTNEPMKLRVRSSGYG PKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPP AVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKV EWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATEC SATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASR RLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLL NRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMR AITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
Recombinant Drosophila sechellia Spastin (spas) is an ATP-dependent microtubule severing protein. It stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Furthermore, it regulates microtubule stability at the neuromuscular junction synapse, influences lipid metabolism by modulating lipid droplet size and distribution, and plays a role in axon regeneration through its regulation of microtubule severing.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

Basic Research Questions

  • What is Drosophila sechellia Spastin and how does it function in cellular processes?

Drosophila sechellia Spastin belongs to the AAA+ ATPase family and functions primarily as a microtubule-severing protein. While most research has focused on D. melanogaster Spastin, both likely share high functional conservation due to evolutionary proximity. Spastin uses energy from ATP hydrolysis to sever and disassemble microtubules, playing crucial roles in microtubule dynamics regulation . In neurons, Spastin is particularly important for synaptic development, with studies in D. melanogaster showing it regulates synaptic microtubule networks at neuromuscular junctions (NMJs) . The protein's activity influences dendrite development in Drosophila da neurons, affecting their morphology and growth patterns . Mutations in spastin cause the most common form of human autosomal dominant hereditary spastic paraplegia (AD-HSP), highlighting its significance in axonal maintenance .

  • What expression systems and purification methods are recommended for producing recombinant Drosophila Spastin?

Based on established protocols for D. melanogaster Spastin, the recommended expression system for D. sechellia Spastin is E. coli . The full-length protein (typically 758 amino acids in D. melanogaster) should be expressed with an affinity tag, such as an N-terminal His-tag, to facilitate purification . The protein can be isolated using affinity chromatography followed by size exclusion chromatography to ensure purity greater than 90% as assessed by SDS-PAGE . After purification, the protein should be maintained in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For long-term storage, lyophilization is recommended, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and addition of 5-50% glycerol before aliquoting and storing at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein activity.

  • What structural and functional domains characterize Drosophila Spastin?

Drosophila Spastin contains several key domains that are essential for its function:

DomainFunctionPosition (based on D. melanogaster)
AAA+ ATPaseATP hydrolysis, provides energy for microtubule severingC-terminal region
Microtubule-binding domainFacilitates interaction with microtubule substratesN-terminal region
MIT (Microtubule Interacting and Trafficking) domainMediates protein-protein interactionsN-terminal region

The protein displays ATPase activity that is essential for its microtubule-severing function . Mutations in the AAA+ ATPase domain, such as the equivalent of human K388R (which would be R388 in the Drosophila protein), abolish ATPase and microtubule-severing activity in vitro . The full protein sequence of D. melanogaster Spastin (which shares high similarity with D. sechellia) is 758 amino acids and contains multiple functional regions that contribute to its cellular localization and activity .

  • How can researchers design experiments to compare the functional conservation between Drosophila and human Spastin?

Functional conservation studies should employ multiple complementary approaches:

  • Genetic rescue experiments: Express human Spastin in Drosophila spastin null backgrounds to assess functional complementation. Research shows that human Spastin can rescue behavioral and cellular defects in D. melanogaster spastin null flies, indicating strong functional conservation .

  • Biochemical activity assays: Compare the ATPase and microtubule-severing activities of both proteins in vitro using purified recombinant proteins and fluorescently labeled microtubules.

  • Mutation analysis: Introduce equivalent mutations into both proteins to determine if they produce similar biochemical defects. For example, the K388R mutation in human Spastin and its equivalent in Drosophila both cause complete loss of ATPase and microtubule-severing activity .

  • Cellular localization studies: Compare subcellular localization patterns using fluorescently tagged proteins in cellular models. At low expression levels, D. melanogaster Spastin-GFP localizes to discrete punctate structures distributed throughout the cytoplasm, suggesting membrane vesicle association .

  • Phenotypic analysis of transgenic models: Compare phenotypes between flies expressing human versus Drosophila Spastin variants under the same regulatory conditions .

  • What are the key phenotypic readouts when studying Spastin function in Drosophila models?

Phenotypic ReadoutDescriptionRelevance
Neuromuscular junction (NMJ) morphologyNumber and clustering of synaptic boutonsSpastin mutants show more numerous and clustered boutons
Microtubule organizationDistribution and density of microtubule networksSpastin null mutants show fewer microtubule bundles within NMJ
Locomotor behaviorClimbing, walking, jumping, and flying abilitiesSpastin-null adults have severe movement defects; they don't fly or jump, climb poorly, and have short lifespans
Neuronal morphologyDendrite growth and branching patternsSpastin regulates dendrite development in da neurons
Synaptic transmissionElectrophysiological assessment of neurotransmitter releaseTransmitter release is impaired in spastin mutants
Eclosion ratesPercentage of pupae developing into adultsSpastin null mutants show reduced eclosion rates that can be rescued by wild-type spastin expression

These readouts provide comprehensive assessment of Spastin's neurological functions across molecular, cellular, and behavioral levels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.