Recombinant Drosophila sechellia Vacuolar ATPase assembly integral membrane protein VMA21 (GM22297)

Shipped with Ice Packs
In Stock

Description

Protein Overview

VMA21 (GM22297) is a 105-amino-acid integral membrane protein encoded by the GM22297 gene in Drosophila sechellia. It shares functional homology with yeast Vma21p, which facilitates the assembly of the V₀ domain of the V-ATPase complex in the endoplasmic reticulum (ER) . The recombinant form is produced via heterologous expression systems, including E. coli, yeast, baculovirus, or mammalian cells .

Key Features:

ParameterDetails
Gene NameGM22297
Protein LengthFull-length (1–105 aa)
TagN-terminal His-tag (for purification)
Purity≥85–90% (SDS-PAGE verified)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Gene Synonyms

SynonymSource
DsecGM22297
Vacuolar ATPase assembly integral membrane protein VMA21
GM22297

Expression Systems

VMA21 (GM22297) is produced in multiple hosts to optimize solubility and functional activity:

HostAdvantages
E. coliHigh yield, cost-effective, ideal for structural studies
Yeast/BaculovirusProper post-translational modifications (e.g., disulfide bonds)
Mammalian cellsNative folding for functional assays

Research Applications

  1. V-ATPase Assembly Studies:

    • Used to investigate the role of VMA21 in chaperoning V₀ subunits (e.g., ATP6V0C) during ER assembly .

    • Serves as a control in assays measuring V-ATPase proton-pumping activity .

  2. Structural Biology:

    • Utilized for X-ray crystallography or cryo-EM to determine VMA21’s interaction with V₀ components .

  3. Diagnostic Tools:

    • Potential use in ELISA kits for detecting VMA21-specific antibodies, though commercial availability is limited .

Challenges and Considerations

  • Proteolytic Sensitivity: Overexpression in E. coli may lead to partial degradation, necessitating careful handling .

  • Functional Validation: Activity assays (e.g., proton pumping) are required to confirm that recombinant VMA21 retains chaperone function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GM22297; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Drosophila sechellia (Fruit fly)
Target Names
GM22297
Target Protein Sequence
MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLNISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex within the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of VMA21 in Drosophila sechellia?

VMA21 functions as an essential assembly factor for the Vacuolar H+-ATPase complex (V-ATPase) in Drosophila sechellia, similar to its role in other organisms. This protein is critical for the proper assembly of the V0 domain of V-ATPase in the endoplasmic reticulum (ER). Specifically, VMA21 initiates assembly by interacting with the proteolipid subunit c', promoting the formation of the proteolipid ring structure. After V0 assembly, VMA21 escorts the complex to the Golgi apparatus, where it combines with the V1 domain to form the functional V-ATPase. Following this process, VMA21 returns to the ER via its KKXX retention motif to participate in additional rounds of V0 assembly .

The properly assembled V-ATPase is crucial for acidification of intracellular compartments, which impacts numerous cellular processes including protein trafficking, autophagy, and lysosomal function. In D. sechellia, this protein may have evolved specialized functions related to the species' unique ecological niche as a specialist of Morinda citrifolia fruit .

How does recombinant D. sechellia VMA21 differ structurally from orthologs in other Drosophila species?

Recombinant D. sechellia VMA21 maintains the core structural elements found in orthologs across Drosophila species, including:

  • Two predicted transmembrane domains

  • A luminal loop region between the transmembrane segments

  • The critical ER retention motif (KKXX) at the C-terminus

Key residues of interest include those in the luminal loop region (similar to position 63 in human VMA21, where mutations affect function) and regions involved in interaction with proteolipid subunits, as these are likely subjected to selective pressure during adaptation to new environments.

What expression systems are most effective for producing functional recombinant D. sechellia VMA21?

For optimal expression of functional recombinant D. sechellia VMA21 (GM22297), researchers should consider the following expression systems and conditions:

Expression SystemAdvantagesConsiderationsRecommended Tags
E. coliHigh yield, cost-effectiveMay require refolding due to membrane protein natureN-terminal His6 with cleavable linker
Insect cells (Sf9/Sf21)Native-like post-translational modificationsHigher cost than bacterial systemsC-terminal FLAG or Strep-tag II
Drosophila S2 cellsSpecies-matched environmentSlower growth compared to Sf9Dual His-TEV-GFP tag for localization studies
Mammalian cellsComplex glycosylation capabilityHighest costHA tag for immunoprecipitation studies

For membrane proteins like VMA21, detergent selection during purification is critical. Start with milder detergents like DDM (n-Dodecyl-β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) to maintain protein folding and function. When expressing in E. coli, consider using specialized strains such as C41(DE3) or C43(DE3) designed for membrane protein expression.

Codon optimization for the expression host is essential, particularly when expressing Drosophila proteins in bacterial systems, to prevent translational pausing and misfolding .

How can researchers assess the functional integrity of recombinant D. sechellia VMA21 in vitro?

Assessing functional integrity of recombinant D. sechellia VMA21 requires multiple complementary approaches:

  • Complementation Assays: Transform VMA21-deficient yeast strains with recombinant D. sechellia VMA21 and assess growth recovery on media requiring functional V-ATPase (e.g., high calcium or alkaline pH). This provides a physiologically relevant readout of protein function.

  • V-ATPase Assembly Analysis:

    • Use blue native PAGE to visualize intact V-ATPase complexes

    • Perform co-immunoprecipitation assays to confirm interaction with V0 subunits

    • Conduct size exclusion chromatography to analyze complex formation

  • Trafficking Assays: Create fluorescently tagged VMA21 to monitor its movement between the ER and Golgi, confirming the protein's ability to perform its escort function.

  • pH-Dependent Functional Assays: Use pH-sensitive fluorescent probes (e.g., LysoSensor) in cell-based systems to measure organelle acidification when supplemented with wild-type versus mutant VMA21.

  • Thermal Shift Assays: Assess protein stability across different pH values and in the presence of octanoic acid, which is relevant to D. sechellia's natural environment .

What are the key considerations when designing experiments to study D. sechellia VMA21's role in octanoic acid tolerance?

When investigating D. sechellia VMA21's potential role in octanoic acid (OA) tolerance, researchers should address several key experimental considerations:

  • Concentration Range: Include OA concentrations of 0.3%, 0.6%, and 1.2% to cover the range found in Morinda citrifolia fruit. The 1.2% concentration represents natural levels that are toxic to most other Drosophila species but tolerated by D. sechellia .

  • Control Species Selection:

    • Include both generalist Drosophila species (e.g., D. melanogaster, D. simulans) and other specialists with different adaptations

    • Ideally use multiple lines of each species to account for intraspecific variation

    • For D. melanogaster, consider using both susceptible (e.g., DGRP_321) and resistant (e.g., DGRP_808) lines

  • Cellular pH Measurements: Monitor organelle pH changes in the presence of OA using ratiometric probes to determine if VMA21-dependent V-ATPase activity helps maintain pH homeostasis in acidic conditions.

  • Gene Expression Analysis: Use qPCR to quantify changes in VMA21 expression levels in response to OA exposure, comparing expression patterns between OA-tolerant D. sechellia and susceptible species.

  • Evolutionary Context: Design comparative experiments that connect VMA21 function to D. sechellia's specialized ecological niche, considering that adaptation to toxic Morinda fruit may have provided an "enemy-free space" with reduced pathogen pressure .

  • Experimental Timeline: Monitor effects over both acute (24-48 hours) and chronic (1-2 weeks) exposure periods, as adaptive responses may differ over time.

A thoughtfully designed experimental protocol would integrate these elements while controlling for variables such as age, sex, and prior dietary history of the experimental organisms.

What methods are recommended for analyzing VMA21's interaction with other V-ATPase assembly factors in Drosophila sechellia?

To thoroughly analyze VMA21's interactions with other V-ATPase assembly factors in D. sechellia, researchers should employ a multi-method approach:

  • Proximity-Based Labeling Techniques:

    • BioID: Fuse a biotin ligase to VMA21 to biotinylate proximal proteins

    • APEX2: Use peroxidase-mediated biotinylation followed by streptavidin pulldown

    • These methods are particularly valuable for capturing transient interactions that occur during assembly

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSS or EDC

    • Apply gentle crosslinking conditions to preserve native interactions

    • Analyze crosslinked peptides by MS to identify interaction interfaces

    • This approach provides detailed spatial information about protein complexes

  • Co-Immunoprecipitation with Quantitative Analysis:

    • Use stable isotope labeling (SILAC) or TMT labeling for quantitative proteomics

    • Compare interactions under normal conditions versus stress conditions (e.g., OA exposure)

    • Include appropriate negative controls using VMA21 with mutations in key interaction domains

  • Yeast Two-Hybrid Membrane System Screening:

    • Use specialized split-ubiquitin systems designed for membrane proteins

    • Screen against a library of other D. sechellia V-ATPase components (TMEM199, CCDC115, ATP6AP1, ATP6AP2 homologs)

    • Validate positive interactions with the methods listed above

  • Genetic Interaction Studies:

    • Create RNAi knockdowns or CRISPR-based mutations of potential interacting partners

    • Assess synthetic phenotypes that may indicate functional relationships

    • Measure V-ATPase assembly efficiency as a functional readout

The interaction data should be analyzed in the context of D. sechellia's unique biology, particularly its adaptation to octanoic acid, which may have driven specialized interactions between VMA21 and other assembly factors.

How can D. sechellia VMA21 be utilized to study evolutionary adaptations in membrane protein function?

Recombinant D. sechellia VMA21 offers a powerful model to study evolutionary adaptations in membrane protein function, particularly in species that have adapted to toxic environments. Several research approaches can leverage this system:

  • Comparative Functional Analysis: Express VMA21 from multiple Drosophila species (generalists versus specialists) in a common cellular background to isolate protein-specific differences in function. Measuring V-ATPase assembly efficiency, trafficking kinetics, and pH regulation capacity will reveal functional adaptations.

  • Domain Swapping Experiments: Create chimeric proteins by swapping domains between D. sechellia VMA21 and orthologs from non-adapted species to identify specific regions responsible for functional differences, particularly those that might contribute to octanoic acid tolerance.

  • Ancestral Sequence Reconstruction: Synthesize inferred ancestral VMA21 sequences to trace the evolutionary trajectory of functional changes, revealing which mutations were selected during D. sechellia's specialization to Morinda fruit.

  • Molecular Evolution Analysis:

SpeciesEcological NicheSelection Pressure on VMA21Predicted Functional Impact
D. sechelliaMorinda fruit specialistPositive selection in transmembrane domainsEnhanced function in acidic, OA-rich environment
D. melanogasterGeneralistPurifying selectionMaintained function across diverse environments
D. buzzatiiCactophilic specialistSelection on protein stabilityAdaptation to desiccation and alkaline pH
D. mojavensisMultiple cactus speciesIntermediate selectionBroader tolerance to diverse cacti toxins
  • Environmental Context Integration: Design experiments that connect VMA21 function to D. sechellia's ecological specialization, testing protein function under conditions mimicking the Morinda fruit environment (high OA, specific pH) .

This research can reveal fundamental principles about how membrane proteins adapt to new environmental challenges and how these adaptations contribute to speciation and ecological specialization.

What are the challenges and solutions when investigating VMA21's role in V-ATPase assembly in D. sechellia compared to human systems?

Investigating VMA21's role in V-ATPase assembly across species presents several challenges with corresponding methodological solutions:

Challenges and Solutions:

  • Structural Differences

    • Challenge: Subtle structural variations between human and D. sechellia VMA21 may affect interaction specificity

    • Solution: Use AlphaFold2 or RosettaFold to generate comparative structural models, followed by molecular dynamics simulations to identify functionally important differences in protein dynamics

  • Assembly Pathway Variations

    • Challenge: The precise order and stoichiometry of assembly may differ between species

    • Solution: Employ time-resolved cryo-EM to capture assembly intermediates and define the assembly pathway in each system

  • Technical Limitations in Drosophila Systems

    • Challenge: Fewer genetic tools available for D. sechellia compared to model organisms

    • Solution: Develop CRISPR-Cas9 protocols optimized for D. sechellia or use heterologous expression in D. melanogaster with genome-edited backgrounds

  • Functional Conservation Assessment

    • Challenge: Determining whether apparent differences reflect true biological variation or experimental artifacts

    • Solution: Create hybrid V-ATPase systems with components from both species to test compatibility and identify species-specific requirements

  • Linking Genotype to Phenotype

    • Challenge: Connecting molecular-level differences to organismal phenotypes

    • Solution: Develop D. sechellia cell lines to enable direct cellular phenotyping under controlled conditions

Comparative Analysis Table:

AspectHuman VMA21D. sechellia VMA21Methodological Consideration
Membrane topologyTwo transmembrane domainsPredicted similar topologyUse bimolecular fluorescence complementation to verify topology in insect cells
Key mutationsp.Asn63Gly causes diseasePosition may have D. sechellia-specific residueCreate equivalent mutations in both proteins to test functional conservation
Cellular localizationER-Golgi circuitPresumably similar, requires verificationUse species-specific antibodies or epitope tags that don't interfere with trafficking
Response to stressReduced expression causes ER stressUnknown in OA-rich environmentTest protein stability and expression in presence of increasing OA concentrations
V-ATPase componentsWell-characterized in humansLess characterized in DrosophilaPerform comparative proteomics of V-ATPase complexes from both systems

This comparative approach will reveal evolutionary adaptations in assembly mechanisms and potentially identify novel therapeutic targets for human V-ATPase-related disorders .

How can researchers utilize D. sechellia VMA21 to investigate host-pathogen interactions in the context of specialized diet adaptations?

Drosophila sechellia's specialized adaptation to Morinda citrifolia fruit provides a unique opportunity to investigate how VMA21-mediated V-ATPase function influences host-pathogen interactions in the context of dietary specialization. This approach connects VMA21 function to broader ecological adaptations:

  • Pathogen Resistance Mechanism Investigation:

    • Research Question: Does dietary octanoic acid (OA) absorption mediated by functional V-ATPase contribute to D. sechellia's resistance to specific pathogens?

    • Methodology: Challenge flies expressing wild-type versus mutant VMA21 with pathogens like Metarhizium anisopliae (Ma549) after feeding them diets with varying OA concentrations

    • Expected Outcome: If functional VMA21 is required for OA-mediated pathogen resistance, flies with mutant VMA21 would show increased susceptibility despite OA consumption

  • Intracellular pH Regulation During Infection:

    • Research Question: Does D. sechellia VMA21 maintain organelle acidification differently during pathogen challenge compared to generalist species?

    • Methodology: Monitor lysosomal and phagosomal pH in hemocytes from different Drosophila species during bacterial or fungal infection

    • Data Collection: Use ratiometric pH-sensitive probes and live-cell imaging to track dynamic pH changes

  • Pathogen Exposure Experiment Design:

Experimental GroupDietVMA21 StatusPathogen ChallengeMeasurements
ControlStandardWild-typeNoneBaseline V-ATPase function
OA Protection+ 0.6% OAWild-typeMa549Survival, fungal load, immune gene expression
VMA21 Requirement+ 0.6% OAKnockdown/MutantMa549Test if VMA21 is required for OA-mediated protection
Direct AntifungalIn vitroN/AMa549 + OATest direct antifungal effects of OA
Generalist Comparison+ 0.6% OAD. melanogaster VMA21Ma549Species-specific VMA21 function
  • Metabolite Analysis:

    • Perform comparative metabolomics on VMA21-expressing versus VMA21-deficient D. sechellia to identify OA-derived compounds that may contribute to pathogen resistance

    • Correlate metabolite production with V-ATPase function and organelle acidification

  • Evolutionary Context Integration:

    • Test the hypothesis that specialization on OA-rich Morinda fruit provided D. sechellia with an "enemy-free space" that reduced selection pressure for strong immune responses

    • Compare immune gene expression profiles between specialist and generalist species when VMA21 function is manipulated

This research approach connects molecular function (VMA21/V-ATPase) with ecological adaptation (diet specialization) and evolutionary outcomes (pathogen resistance), providing insights into how membrane protein adaptations contribute to niche specialization and host-pathogen dynamics.

What are common issues when producing recombinant D. sechellia VMA21 and how can they be addressed?

Producing recombinant D. sechellia VMA21 presents several challenges due to its nature as a membrane protein and its specific functional requirements. Here are common issues researchers encounter and recommended solutions:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in standard systems

    • Solution: Use specialized expression vectors with strong but controllable promoters (e.g., pET-28a with T7lac promoter for bacterial systems); optimize induction conditions (lower temperature of 18°C, reduced inducer concentration); consider using Baculovirus Expression Vector System (BEVS) for insect cell expression

  • Protein Misfolding and Aggregation:

    • Problem: Improper folding in the expression host's membrane environment

    • Solution: Co-express with molecular chaperones (e.g., DnaK/DnaJ/GrpE in bacterial systems); add chemical chaperones like glycerol (10%) or DMSO (2-5%) to culture media; use fusion partners like MBP or SUMO that enhance solubility

  • Purification Difficulties:

    • Problem: Poor extraction from membranes or loss of activity during purification

    • Solution: Screen multiple detergents (start with DDM, LMNG, or GDN); use lipid nanodiscs or SMALPs (styrene-maleic acid lipid particles) to maintain a native-like lipid environment; perform detergent exchange during purification

  • Loss of Functional Activity:

    • Problem: Purified protein lacks ability to promote V-ATPase assembly

    • Solution: Include stabilizing lipids (e.g., cholesterol, specific phospholipids) during purification; verify proper disulfide bond formation; maintain appropriate pH throughout purification process

  • Quality Control Checklist:

Quality ParameterMethodAcceptance CriteriaTroubleshooting
PuritySDS-PAGE, Size Exclusion Chromatography>90% purityOptimize wash conditions, consider additional purification step
Membrane InsertionProtease Protection AssayProtected transmembrane domainsVerify signal sequence recognition, adjust membrane extraction
Oligomeric StateBlue Native PAGE, SEC-MALSCorrect oligomeric profileAdjust detergent:protein ratio, test different buffer conditions
Thermal StabilityDifferential Scanning FluorimetryTm >40°CAdd stabilizing agents, optimize buffer composition
Functional ActivityV-ATPase Assembly AssayComparable to native proteinEnsure critical post-translational modifications, verify folding
  • Expression Host Considerations:

    • For studying function in the context of OA tolerance, consider using D. sechellia cell lines or D. melanogaster S2 cells with controlled OA exposure to maintain relevance to the protein's natural environment

Implementing these solutions systematically will improve the quality and yield of recombinant D. sechellia VMA21 for functional studies.

How can researchers validate that recombinant D. sechellia VMA21 maintains native conformation and function?

Validating the native conformation and function of recombinant D. sechellia VMA21 requires a multi-faceted approach combining structural and functional analyses:

  • Structural Validation Methods:

    a. Circular Dichroism (CD) Spectroscopy:

    • Determine secondary structure content (α-helices and β-sheets)

    • Compare spectrum with predicted structure based on homology models

    • Thermal stability analysis to assess proper folding

    b. Limited Proteolysis:

    • Correctly folded proteins show specific digestion patterns

    • Compare digestion profiles of recombinant versus native protein (if available)

    • Resistant core fragments indicate stable structural domains

    c. Epitope Accessibility:

    • Use conformation-specific antibodies to verify native folding

    • Compare epitope recognition between recombinant and endogenous protein

    • Consider developing antibodies against predicted extramembrane loops

  • Functional Validation Approaches:

    a. Complementation Assays:

    • Express recombinant VMA21 in VMA21-deficient systems (yeast vma21Δ mutants)

    • Measure rescue of growth defects on media requiring functional V-ATPase

    • Quantify V-ATPase assembly efficiency compared to wild-type controls

    b. Binding Assays:

    • Verify interactions with V0 domain components, particularly the c' subunit

    • Use microscale thermophoresis (MST) or surface plasmon resonance (SPR)

    • Compare binding affinities with those of native protein or related orthologs

    c. Subcellular Localization:

    • Confirm proper ER-Golgi trafficking using fluorescent fusion proteins

    • Verify retention in ER via the KKXX motif

    • Co-localization with known ER and V-ATPase markers

  • Functional Readouts in Cellular Systems:

Functional ParameterAssay MethodExpected ResultIndication of Proper Function
V-ATPase AssemblyCo-immunoprecipitationAssociation with V0 componentsProper chaperone activity
Organelle AcidificationLysoSensor StainingAcidified lysosomes/vacuolesDownstream functional V-ATPase
Response to OACell viability with OA exposureEnhanced survival with functional VMA21Species-specific adaptation
Trafficking KineticsFRAP or pulse-chaseProper ER-Golgi movementFunctional escort activity
Stress ResponseER stress markers (BiP, XBP1 splicing)Minimal ER stress inductionProper folding environment
  • Species-Specific Validation:

    • Compare function in the context of octanoic acid exposure, which is relevant to D. sechellia's natural environment

    • Test pH homeostasis under conditions mimicking Morinda fruit chemistry

    • Verify any predicted adaptive features that distinguish it from orthologs in non-specialist species

These comprehensive validation approaches ensure that recombinant D. sechellia VMA21 accurately represents the native protein for meaningful research applications.

How can comparative studies of VMA21 across Drosophila species inform our understanding of protein evolution in specialized niches?

Comparative analysis of VMA21 across Drosophila species offers valuable insights into protein evolution during adaptation to specialized ecological niches. This research direction can be approached through several methodological frameworks:

  • Molecular Evolution Analysis:

    • Calculate selection pressures (dN/dS ratios) on VMA21 coding sequences across Drosophila species with varying ecological niches

    • Identify specific codons under positive selection, particularly in species that have adapted to toxic or extreme environments

    • Map selected residues onto structural models to determine their functional significance

  • Structure-Function Relationship Studies:

    • Express and characterize VMA21 from multiple species (D. sechellia, D. melanogaster, D. simulans, D. buzzatii) in a common cellular background

    • Measure functional parameters including V-ATPase assembly efficiency, pH regulation, and stress tolerance

    • Correlate functional differences with specific amino acid variations to identify key adaptive changes

  • Ecological Context Integration:

    • Design experiments that test VMA21 function under conditions mimicking natural host environments

    • For D. sechellia, this would include octanoic acid exposure at concentrations found in Morinda fruit

    • For cactophilic species like D. buzzatii, test function under alkaline and desiccating conditions

  • Comparative Performance Matrix:

  • Ancestral Sequence Reconstruction:

    • Synthesize inferred ancestral VMA21 sequences at key nodes in the Drosophila phylogeny

    • Characterize ancestral protein function to trace the evolutionary trajectory of adaptations

    • Identify when key adaptive mutations arose in relation to ecological shifts

  • Connection to Host-Pathogen Dynamics:

    • Test the hypothesis that specialization on Morinda fruit provided D. sechellia with an "enemy-free space" that reduced pathogen pressure

    • Investigate if VMA21 adaptations are linked to changes in immunity or resistance to specific pathogens

    • Challenge different species with entomopathogenic fungi like Metarhizium anisopliae while manipulating VMA21 function

This research approach connects molecular evolution to ecological adaptation, revealing how membrane proteins like VMA21 contribute to speciation and niche specialization while maintaining essential cellular functions across diverse environmental contexts.

What insights can D. sechellia VMA21 provide for understanding human VMA21-related disorders?

The study of D. sechellia VMA21 offers valuable insights for understanding human VMA21-related disorders through comparative molecular and functional analyses:

  • Disease Mechanism Insights:

    • Human VMA21 mutations cause X-linked myopathy with excessive autophagy (XMEA) and a congenital disorder of glycosylation (CDG)

    • D. sechellia VMA21 can serve as a comparative model to understand how sequence variations impact V-ATPase assembly and function

    • The protein's adaptation to octanoic acid in D. sechellia may reveal mechanisms of stress response relevant to understanding pathological conditions

  • Structure-Function Correlations:

    • Key disease-causing mutations in humans (e.g., p.Asn63Gly) occur in the luminal loop region

    • Creating equivalent mutations in D. sechellia VMA21 can determine if pathogenic mechanisms are conserved across species

    • Analyzing naturally occurring variations in D. sechellia VMA21 that maintain function despite environmental stress may identify resilience factors

  • Membrane Protein Stability Mechanisms:

    • D. sechellia's adaptation to toxic compounds may have selected for enhanced VMA21 stability

    • Understanding these stabilizing features could inform therapeutic approaches for human VMA21 mutations that compromise protein stability

    • Comparative molecular dynamics simulations can identify key stabilizing interactions

  • Translational Research Applications:

Human Disease FeatureD. sechellia VMA21 Research ApproachPotential Translational Insight
Reduced VMA21 mRNA stability in CDGCompare mRNA stability mechanisms across speciesIdentify regulatory elements that enhance expression
Misassembly of V-ATPase in XMEAStudy assembly dynamics in D. sechellia under stressDiscover compensatory mechanisms that maintain assembly
Lipid droplet accumulationInvestigate lipid metabolism in D. sechellia exposed to OAReveal adaptive responses to lipid stress
ER stress in VMA21 deficiencyAnalyze ER stress responses in D. sechelliaIdentify species-specific stress tolerance mechanisms
Lysosomal dysfunctionCompare lysosomal acidification efficiencyDiscover factors that enhance V-ATPase function
  • Therapeutic Strategy Development:

    • D. sechellia's natural adaptations may inspire approaches to enhance VMA21 function in disease states

    • Identify small molecules that mimic stabilizing interactions found in D. sechellia VMA21

    • Develop peptides based on D. sechellia VMA21 sequences that enhance V-ATPase assembly

  • Experimental Models:

    • Develop humanized Drosophila models expressing human VMA21 variants

    • Use CRISPR-engineered D. sechellia with human-equivalent mutations

    • Create cell lines expressing chimeric proteins to identify functional domains

This comparative approach can reveal fundamental principles about VMA21 function while potentially identifying novel therapeutic targets for human V-ATPase-related disorders .

What future research directions could exploit the unique properties of D. sechellia VMA21 for biotechnological applications?

The unique properties of D. sechellia VMA21, particularly its function in an octanoic acid-rich environment, open several promising avenues for biotechnological applications:

  • Stress-Resistant Protein Engineering:

    • Use D. sechellia VMA21 as a template to engineer membrane proteins with enhanced stability in harsh industrial conditions

    • Identify specific amino acid substitutions that confer resistance to organic acids and incorporate these into biotechnologically relevant proteins

    • Develop computational models based on D. sechellia VMA21 adaptations to predict stabilizing mutations for other membrane proteins

  • Bioprocess Enhancement Applications:

    • Express modified VMA21 in production organisms to improve tolerance to organic acids in fermentation processes

    • Engineer V-ATPase assembly to enhance pH homeostasis in yeast or bacterial bioreactors

    • Develop strains with improved tolerance to toxic fermentation byproducts

  • Biosensor Development:

    • Create biosensors based on D. sechellia VMA21 that detect octanoic acid or similar fatty acids

    • Couple VMA21 conformational changes to reporter systems for environmental monitoring

    • Develop whole-cell biosensors with modified VMA21 to detect environmental toxins

  • Potential Applications in Various Fields:

Industry SectorApplication ConceptUnderlying VMA21 PropertyDevelopment Approach
Biofuel ProductionEnhanced tolerance to fatty acid byproductsAdaptation to octanoic acidExpress in production yeast/bacteria
Pharmaceutical ManufacturingImproved organelle pH control in protein productionV-ATPase assembly functionOptimize secretory pathway in CHO cells
Agricultural BiotechnologyPest control through targeted disruptionSpecies-specific differencesDevelop selective V-ATPase inhibitors
BioremediationOrganic acid-degrading microorganismsStress tolerance mechanismsEngineer enhanced survival in contaminated environments
Drug DeliverypH-responsive nanocarrierspH-sensing domainsDevelop biomimetic delivery vehicles
  • Structure-Based Drug Design:

    • Use the unique structural features of D. sechellia VMA21 to design selective inhibitors of insect V-ATPases

    • Exploit species-specific differences for pest control applications

    • Develop compounds that selectively target pathogen V-ATPases while sparing human orthologs

  • Synthetic Biology Applications:

    • Incorporate D. sechellia VMA21 into synthetic organelles with controlled pH

    • Design artificial cellular compartments with specialized functions

    • Develop synthetic circuits that respond to organic acid stress

  • Future Research Priorities:

    • Determine the crystal or cryo-EM structure of D. sechellia VMA21 to enable rational design applications

    • Identify the complete interactome of VMA21 under various stress conditions

    • Map the regulatory networks controlling VMA21 expression in response to environmental challenges

These biotechnological applications leverage the evolutionary adaptations that have allowed D. sechellia to thrive in its specialized ecological niche, potentially addressing challenges in industrial bioprocessing, environmental monitoring, and pharmaceutical development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.