Recombinant Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Full Length Drosophila simulans Adenosine Monophosphate-Protein Transferase FICD homolog (GD23409) is a protein that is expressed in E. coli . It functions as an adenosine monophosphate-protein transferase and De-AMPylase Fic . The recombinant protein is fused to an N-terminal His tag and is available as a lyophilized powder .

Table 1: Product Information

Cat.No.RFL1587DF
Product OverviewRecombinant Full Length Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409) Protein
SpeciesDrosophila simulans (Fruit fly)
SourceE. coli
TagHis
Protein LengthFull Length (1-492)
FormLyophilized powder
Gene NameGD23409
SynonymsGD23409; Protein adenylyltransferase Fic; De-AMPylase Fic
UniProt IDB4Q4M7
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol for long-term storage.
AA SequenceMCMEAEPPSPPAQQQEQVNPPLCKAQNPKPARLYRLVLLFVAGSLAAWTFHALSSTNLVWKLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALGALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQALTISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHSSTLHPVNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSILEFYESGSGDIP

Biological Context

Drosophila simulans is a species of fruit fly closely related to Drosophila melanogaster . Studies of Drosophila are frequently used to understand genetic and biological processes, including those related to metabolism, energy homeostasis, and responses to environmental factors such as pesticides .

Function and Significance

The FICD homolog functions as an adenosine monophosphate-protein transferase, catalyzing the transfer of AMP to target proteins, a process known as AMPylation . It may also function as a De-AMPylase Fic . Adenosine monophosphate-activated protein kinase (AMPK) is a highly conserved serine/threonine kinase that plays a key role in regulating cellular energy balance . AMPK is activated by increases in the AMP:ATP ratio, which occur under conditions of cellular stress, such as energy depletion . Once activated, AMPK promotes ATP-producing pathways while inhibiting ATP-consuming processes .

Potential Applications

  1. Research Tool: Recombinant GD23409 can be used in biochemical assays to study its enzymatic activity, substrate specificity, and regulation .

  2. Drug Discovery: Understanding the role of GD23409 in cellular processes may provide insights for developing drugs that target this enzyme or related pathways .

  3. Agricultural Research: Given the role of Drosophila simulans as an agricultural pest, studying GD23409 may identify novel targets for pest control .

  4. Understanding Transposon Dynamics: GD23409 may be used in the study of transposon dynamics in Drosophila simulans populations .

  5. Genetic Studies: GD23409 may be used in genetic studies to reveal an abundance of genetic variation in Drosophila simulans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GD23409; Protein adenylyltransferase Fic; De-AMPylase Fic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Drosophila simulans (Fruit fly)
Target Names
GD23409
Target Protein Sequence
MCMEAEPPSPPAQQQEQVNPPLCKAQNPKPARLYRLVLLFVAGSLAAWTFHALSSTNLVW KLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALG ALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQAL TISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAYFQHI YHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDITIK DILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHSSTLHP VNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANE GDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSI LEFYESGSGDIP
Uniprot No.

Target Background

Function

This protein acts as a dual-function enzyme, mediating both the addition (AMPylation) and removal (de-AMPylation) of adenosine 5'-monophosphate (AMP) to/from target proteins. The Glu-247 residue dictates whether AMPylation or de-AMPylation occurs. It plays a crucial role in regulating the unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation status of Hsc70-3/BiP. Under unstressed conditions, it functions as an adenylyltransferase, AMPylating Hsc70-3/BiP at Thr-518, thus inactivating it. In response to endoplasmic reticulum stress, it acts as a phosphodiesterase, removing AMP from Hsc70-3/BiP at Thr-518, thereby restoring HSPA5/BiP activity.

Protein Families
Fic family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of FICD homolog in Drosophila simulans and how does it compare to human FICD?

The FICD homolog in D. simulans functions as an adenyltransferase enzyme that catalyzes both AMPylation and deAMPylation, similar to its human counterpart. AMPylation involves the transfer of adenosine monophosphate (AMP) from adenosine triphosphate (ATP) to target proteins, serving as a critical regulatory mechanism in cellular functions . In humans, the ER-resident AMP transferase FICD (also known as HYPE) is involved in regulating BiP chaperone activity, which is essential for endoplasmic reticulum homeostasis and protein folding . The D. simulans FICD homolog likely performs similar functions in regulating protein folding responses, although species-specific differences in regulatory mechanisms may exist.

What structural domains are critical for the enzymatic function of D. simulans FICD?

Based on structural analysis of human FICD, the D. simulans homolog likely contains several crucial domains including:

  • A catalytic Fic domain responsible for AMPylation activity

  • TPR motifs that mediate specific binding to target substrates

  • A highly conserved region equivalent to the TLLFATTEY sequence (amino acids 428-436) in human FICD

The interaction between FICD and its substrates involves specific residue contacts. In human FICD-BiP interactions, several key contact points have been identified:

FICD wt ResidueBiP ResidueDistance (Å)
Thr80Thr4622.962
Ser83Ser4523.017
Thr90Ser4482.104
Thr90Ser4483.000
Asn111Asp4133.185
Asn111Asp4132.706
Gln112Asn2392.910
Gln112Asp4132.879
Lys121Asp2382.902
Lys121Asp2382.149
Lys124Asp2382.654
Lys127Glu2432.989
Thr237Arg4923.553

These contact points are likely conserved in D. simulans FICD and are critical for substrate recognition.

What expression systems are optimal for recombinant D. simulans FICD production?

For successful expression of recombinant D. simulans FICD homolog (GD23409), researchers should consider the following expression systems:

The expression construct should include:

  • A strong inducible promoter (T7 for bacterial systems, polyhedrin for baculovirus)

  • An appropriate affinity tag (6xHis, GST, or MBP) for purification

  • A precision protease cleavage site for tag removal

  • Codon optimization for the chosen expression system

What purification strategy provides the highest yield and activity for recombinant D. simulans FICD?

A multi-step purification strategy is recommended:

  • Initial capture: Affinity chromatography using the engineered tag (Ni-NTA for His-tagged proteins or glutathione for GST-tagged proteins)

  • Intermediate purification: Ion exchange chromatography to separate species with different surface charges

  • Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity

Critical buffer considerations include:

  • Maintaining pH between 7.0-8.0

  • Including stabilizing agents such as glycerol (10-20%)

  • Adding reducing agents (DTT or TCEP) to prevent disulfide formation

  • Including appropriate salt concentration (typically 100-300 mM NaCl)

  • Considering ATP or non-hydrolyzable ATP analogs to stabilize the protein structure

What methods can be employed to measure the AMPylation activity of D. simulans FICD?

Several complementary approaches can be used to assess AMPylation activity:

  • Radioactive assays: Using α-32P-ATP as a substrate to track the transfer of radioactive AMP to target proteins, followed by SDS-PAGE and autoradiography or phosphorimaging quantification.

  • Mass spectrometry-based approaches: Detecting the mass shift (+329 Da) corresponding to AMP addition on target proteins, enabling identification of specific modified residues.

  • Immunological detection: Using antibodies specific to AMPylated proteins (if available) or detecting the AMP moiety through chemical tagging strategies.

  • Fluorescence-based assays: Utilizing fluorescently labeled ATP analogs that allow real-time monitoring of the AMPylation reaction kinetics.

For accurate kinetic characterization, researchers should determine:

  • Km and Vmax values for ATP and protein substrates

  • Effects of pH, temperature, and ionic strength on enzyme activity

  • Requirements for metal cofactors (typically Mg2+ for ATP-dependent enzymes)

How can researchers investigate the structural basis for substrate recognition by D. simulans FICD?

To elucidate structural determinants of substrate recognition:

  • Crosslinking approaches: Using thiol-reactive derivatives of ATP to covalently stabilize the transient FICD:substrate complex, similar to the approach used with human FICD and BiP .

  • Alanine scanning mutagenesis: Systematically mutating surface residues of FICD to identify regions critical for substrate binding.

  • Crystallography: Determining the structure of D. simulans FICD alone and in complex with its substrates, potentially using the crosslinking approach mentioned above to stabilize transient interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping regions of FICD that become protected upon substrate binding, indicating interaction surfaces.

What genetic approaches can be used to study FICD function in D. simulans?

Several genetic approaches can be employed:

  • CRISPR-Cas9 genome editing: For creating precise knockouts or point mutations in the endogenous FICD gene. The approach would be similar to methods used to generate inversions in D. simulans as described in recent studies .

  • RNAi knockdown: Using transgenic fly lines expressing dsRNA targeting FICD under tissue-specific or inducible promoters.

  • Overexpression studies: Creating transgenic flies expressing wild-type or mutant versions of FICD to assess gain-of-function phenotypes.

  • Balancer chromosomes: Utilizing D. simulans-specific balancer chromosomes such as j2LM1 and j3RM1 to maintain and track FICD mutations .

When designing genetic approaches, researchers should consider the unique genetic characteristics of D. simulans, including its higher recombination rates compared to D. melanogaster, particularly around centromeric regions, and its distinct response to inversions .

How does D. simulans' genetic background influence FICD functional studies?

When studying FICD in D. simulans, researchers should be aware of several species-specific considerations:

How can researchers investigate the role of FICD in ER stress responses in D. simulans?

To elucidate FICD's role in ER stress:

  • Comparative transcriptomics: Analyze gene expression profiles of wild-type versus FICD mutant flies under normal conditions and ER stress conditions (induced by tunicamycin or thapsigargin).

  • Fluorescent reporters: Develop UPR reporters in D. simulans, such as XBP1-GFP fusion constructs, to visualize ER stress responses in vivo in FICD mutant backgrounds.

  • Biochemical characterization: Monitor changes in BiP AMPylation status under different ER stress conditions and correlate with FICD activity levels.

  • Physiological assays: Assess sensitivity to ER stressors in FICD mutant flies by measuring survival rates, developmental timing, and tissue-specific effects.

  • Genetic interaction studies: Create double mutants combining FICD mutations with mutations in known UPR pathway components to establish epistatic relationships.

What approaches can identify novel substrates of D. simulans FICD beyond BiP?

To discover new FICD substrates:

  • Proximity labeling: Use BioID or APEX2 fusion proteins with FICD to identify proteins in close proximity in vivo.

  • Quantitative proteomics: Compare AMPylated proteins in wild-type versus FICD-deficient flies using mass spectrometry approaches.

  • Candidate approach: Test known human FICD substrates for AMPylation by D. simulans FICD in vitro.

  • ATP analog-sensitive FICD engineering: Create engineered FICD variants that can utilize ATP analogs with bulky groups, allowing specific labeling of direct substrates.

  • Structural prediction: Use the known interaction between FICD and BiP to computationally predict other proteins with similar binding motifs.

How has FICD function evolved across Drosophila species?

To investigate evolutionary aspects of FICD:

  • Phylogenetic analysis: Compare FICD sequences across Drosophila species and other insects to identify conserved domains and species-specific adaptations.

  • Functional complementation: Test whether FICD from different Drosophila species can rescue phenotypes in D. simulans FICD mutants.

  • Substitution rate analysis: Calculate dN/dS ratios to identify regions under purifying or positive selection.

  • Substrate conservation: Determine whether FICD targets the same proteins across different Drosophila species by comparative proteomics.

What can the study of D. simulans FICD reveal about tissue-specific functions of AMPylation?

For tissue-specific analysis:

  • Tissue-specific knockdown: Use GAL4-UAS systems adapted for D. simulans to achieve tissue-restricted FICD expression or knockdown.

  • Immunohistochemistry: Develop antibodies against AMPylated proteins to visualize tissue-specific patterns of FICD activity.

  • Single-cell transcriptomics: Compare FICD expression and UPR signatures at single-cell resolution across tissues.

  • Ex vivo tissue culture: Develop primary culture systems from different D. simulans tissues to study FICD function under controlled conditions.

  • Tissue-specific rescue experiments: Express FICD in specific tissues of FICD mutant flies to determine which phenotypes can be rescued by tissue-restricted expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.