Recombinant Drosophila simulans ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila simulans ATP synthase subunit a

ATP synthase subunit a, also known as mt:ATPase6, is a key component of the mitochondrial ATP synthase complex. In Drosophila simulans, this protein is encoded by the mitochondrial genome and plays a crucial role in the proton channel of the ATP synthase complex . The recombinant form of this protein refers to the artificially produced version created through molecular biology techniques, typically expressed in bacterial systems such as Escherichia coli . This recombinant protein allows researchers to study the structure, function, and evolutionary significance of mt:ATPase6 without the complexities of isolating it from natural sources.

The full-length Drosophila simulans ATP synthase subunit a consists of 224 amino acids and is a component of the membrane-embedded F0 portion of the ATP synthase complex . This complex is responsible for coupling the proton gradient across the inner mitochondrial membrane to the synthesis of ATP through a rotary mechanism .

Function in Mitochondrial Bioenergetics

The mt:ATPase6 protein serves as a key component of the proton channel within the ATP synthase complex. It plays a direct role in the translocation of protons across the mitochondrial membrane, which is essential for the chemiosmotic coupling that drives ATP synthesis .

Mechanism of Action

ATP synthase functions through a rotary mechanism where the flow of protons through the membrane-embedded F0 portion (which includes the mt:ATPase6 subunit) drives rotation of the central stalk. This rotation causes conformational changes in the catalytic F1 portion, leading to ATP synthesis from adenosine diphosphate (ADP) and inorganic phosphate . The mt:ATPase6 subunit is critical for maintaining the proton gradient necessary for this process.

Studies on ATP synthase mutations in related Drosophila species have shown that disruptions to the complex can lead to severe bioenergetic consequences. For example, mutations in ATP synthase subunits in D. melanogaster result in reduced ATP synthesis and abnormal mitochondrial morphology . While these studies were not conducted specifically on D. simulans mt:ATPase6, they provide insight into the critical role of ATP synthase components in mitochondrial function across Drosophila species.

Production of Recombinant Drosophila simulans ATP synthase subunit a

The recombinant form of D. simulans mt:ATPase6 is primarily produced for research purposes. According to product information, the full-length protein (amino acids 1-224) is typically expressed in E. coli expression systems with an N-terminal histidine tag to facilitate purification .

Expression and Purification

The recombinant protein production process typically involves:

  1. Cloning the mt:ATPase6 gene sequence into an appropriate expression vector

  2. Transformation of the construct into an E. coli expression strain

  3. Induction of protein expression under controlled conditions

  4. Cell lysis and extraction of the recombinant protein

  5. Purification using affinity chromatography, taking advantage of the histidine tag

  6. Quality control assessment through methods such as SDS-PAGE

The purified recombinant protein is typically provided as a lyophilized powder or in a storage buffer containing glycerol to maintain stability . Specific storage recommendations include keeping the protein at -20°C or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week .

Evolutionary Significance

The evolutionary genetics of the mitochondrial genome, including the mt:ATPase6 gene, has been extensively studied in Drosophila simulans. This species is characterized by three main global haplotypes—siI, siII, and siIII—that diverge from each other at approximately 2.5% of nucleotide positions .

Haplotype Variation and Functional Consequences

Research on D. simulans mitochondrial haplotypes has revealed functional consequences of variation in mitochondrial genes, including mt:ATPase6. Studies involving introgression of different haplotypes into various nuclear backgrounds have demonstrated effects on larval development times and adult male survival . Specifically, flies with the siI haplotype exhibited faster development times but lower survival probability compared to other haplotypes, suggesting a life-history trade-off linked to mitochondrial DNA variation .

Further comparisons between siII and siIII haplotypes indicated differences in cytochrome c oxidase activity, starvation resistance, egg size, fecundity, and recovery from cold exposure . While these studies did not isolate the effects of mt:ATPase6 specifically, they demonstrate the functional significance of mitochondrial genetic variation in D. simulans, of which mt:ATPase6 is a component.

Interspecific Incompatibilities

Research on mitonuclear interactions has identified cases where D. simulans mitochondrial DNA, when expressed in a D. melanogaster nuclear background, creates incompatibilities . In particular, a specific SNP in the mitochondrial tRNA for tyrosine in D. simulans, along with a nonsynonymous polymorphism in the nuclear-encoded aminoacyl-tRNA synthetase for tyrosine, creates a mitonuclear incompatibility . While this particular interaction does not directly involve mt:ATPase6, it illustrates the complex interactions between mitochondrial and nuclear genes that can affect mitochondrial function and potentially influence ATP synthase performance.

Research Applications

Recombinant D. simulans mt:ATPase6 has several important research applications in various fields:

Evolutionary and Comparative Biology

The protein serves as a valuable tool for studying evolutionary processes and comparative mitochondrial genetics. By comparing the structure and function of mt:ATPase6 across different Drosophila species and populations, researchers can gain insights into:

  • Patterns of molecular evolution in mitochondrial genes

  • Selection pressures acting on energy production pathways

  • Mechanisms of co-evolution between mitochondrial and nuclear genomes

  • Species-specific adaptations in bioenergetic systems

Mitochondrial Disease Research

Mutations in ATP synthase components are associated with various mitochondrial disorders in humans. The study of recombinant mt:ATPase6 from model organisms like D. simulans provides valuable insights for understanding these conditions. Drosophila models have been established for studying mitochondrial disorders, with mutations in ATP synthase subunits resulting in phenotypes such as developmental delay, early lethality, sterility, and neurological defects .

The mt:ATPase6 protein is particularly relevant as mutations in the human homolog (MT-ATP6) are associated with conditions such as Neuropathy, Ataxia, and Retinitis Pigmentosa (NARP) syndrome and mitochondrial spastic paraplegia . The recombinant D. simulans protein allows for comparative studies that may illuminate the molecular mechanisms of these disorders.

Bioenergetics and Mitochondrial Function

The recombinant protein enables detailed investigation of:

  • Structure-function relationships in ATP synthase

  • Mechanisms of proton transport through the membrane

  • Efficiency of ATP production under different conditions

  • Effects of specific mutations on ATP synthase activity

Future Research Directions

As research on mitochondrial function continues to advance, several promising directions emerge for future studies involving recombinant D. simulans mt:ATPase6:

Mitonuclear Interactions

Further investigation of interactions between mitochondrial ATP synthase subunits and nuclear-encoded components could reveal important aspects of mitonuclear co-evolution and compatibility. Drosophila cybrid models, where mitochondrial DNA from one strain or species is expressed with the nuclear genome of another, offer powerful tools for such research .

Development of Novel Research Tools

The recombinant protein could serve as a foundation for developing new research tools, such as antibodies specific to D. simulans mt:ATPase6 or fluorescently labeled variants for tracking ATP synthase dynamics in living systems.

Challenges in Working with Recombinant mt:ATPase6

Despite its research value, working with recombinant mt:ATPase6 presents several challenges:

  1. The highly hydrophobic nature of the protein makes expression and purification difficult

  2. Maintaining the proper folding and functional state outside of the membrane environment requires specialized techniques

  3. The protein's natural role as part of a large multisubunit complex means that studying it in isolation may not fully reflect its in vivo properties

  4. Species-specific differences may limit the direct application of findings to human mitochondrial disorders

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila simulans (Fruit fly)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSAIFNLSLNWLSTFLGLLMIPSIYWLMPSRYNIVWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWIN HTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGP SMSYLLVTFLLTAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembraneous catalytic core F1 and the membrane-bound proton channel F0, connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton translocation across the membrane.
Database Links

KEGG: dsi:ATP6

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Why use Drosophila as a model for studying ATP synthase functionality?

Drosophila provides an excellent model system for studying ATP synthase function for several key reasons. First, the mitochondrial ATP synthase components are highly conserved across species, making findings in Drosophila relevant to understanding human pathologies . Second, Drosophila offers powerful genetic tools that allow for targeted mutations and gene expression manipulation .

Studies have demonstrated that mutations in Drosophila ATP synthase genes recapitulate key features of human mitochondrial disorders, including neuromuscular dysfunction, mitochondrial morphology defects, and reduced ATP production . The short lifespan and rapid development of Drosophila enable efficient study of age-related phenotypes, while its complex organ systems allow investigation of tissue-specific effects of ATP synthase dysfunction .

Additionally, Drosophila cell lines such as S2 cells provide valuable in vitro systems for high-throughput screening approaches, as demonstrated in genome-wide RNAi screens that have identified novel factors involved in mtDNA maintenance and ATP synthase function .

How does recombinant Drosophila simulans mt:ATPase6 differ from native protein?

The recombinant Drosophila simulans mt:ATPase6 protein typically includes modifications to facilitate purification and experimental manipulation. The most common modification is the addition of an N-terminal His-tag, which enables efficient protein purification using affinity chromatography .

While the core amino acid sequence remains identical to the native protein (amino acids 1-224), several key differences should be considered when interpreting experimental results:

  • Expression system: The recombinant protein is typically produced in E. coli rather than in mitochondria, which may affect post-translational modifications .

  • Tag additions: The His-tag introduces additional amino acids that are not present in the native protein.

  • Solubility considerations: As a membrane protein, solubilization methods must be carefully optimized to maintain proper folding when extracted from its native lipid environment.

  • Functional context: The recombinant protein is studied in isolation, while in vivo it functions as part of a multi-subunit complex within the mitochondrial inner membrane.

These differences necessitate careful validation of recombinant protein studies through complementary in vivo approaches to confirm biological relevance .

What are the molecular mechanisms by which mutations in mt:ATPase6 cause mitochondrial dysfunction?

Mutations in mt:ATPase6 disrupt mitochondrial function through multiple interconnected pathways. Research in Drosophila models has revealed that pathogenic mutations in ATP6 lead to:

  • Impaired proton translocation: Mutations affecting the proton channel disrupt the proton gradient across the inner mitochondrial membrane, reducing the driving force for ATP synthesis .

  • Structural destabilization of ATP synthase: Studies have demonstrated ultrastructural defects in the mitochondrial inner membrane, suggesting impaired assembly or stability of the ATP synthase complex .

  • Reduced ATP synthase activity: Direct biochemical measurements show marked reduction in ATP synthase activity, leading to energy deficiency within affected cells .

  • Increased ROS production: ATP synthase knockdown precipitates a burst of mitochondrial reactive oxygen species (ROS), creating oxidative stress that further damages mitochondrial components .

  • Altered mtDNA maintenance: Dysfunction in ATP synthase correlates with depletion of mitochondrial DNA copy number through mechanisms involving increased mitochondrial turnover .

These pathways ultimately converge to create cellular energy deficits, oxidative damage, and impaired mitochondrial quality control, explaining the progressive, degenerative nature of disorders associated with mt:ATPase6 mutations .

How does ATP synthase dysfunction affect mtDNA copy number maintenance?

The relationship between ATP synthase function and mtDNA copy number maintenance represents an important area of research. Genome-wide RNAi screening in Drosophila S2 cells has revealed that knockdown of multiple ATP synthase subunits leads to significant reduction in mtDNA copy number .

This association appears mediated through several potential mechanisms:

  • ROS-induced mtDNA damage: ATP synthase dysfunction triggers increased ROS production, which can directly damage mtDNA and activate degradation pathways .

  • Altered mitochondrial turnover: Following ATP synthase knockdown, increased mitochondrial turnover is observed, though interestingly, this process does not depend on canonical autophagy machinery .

  • Bioenergetic sensing: Depletion of ATP synthase may alter the ATP/ADP ratio, potentially triggering signaling cascades that regulate mtDNA replication.

  • Direct sensing mechanism: Evidence suggests ATP synthase itself may function as a sensor that modulates mtDNA copy number in response to bioenergetic status .

The finding that ATP synthase subunits from both F₀ and F₁ subcomplexes were identified in screens for mtDNA maintenance genes supports a model where ATP synthase function, rather than just its assembly, is critical for maintaining proper mtDNA levels .

What is the relationship between ATP synthase assembly and translation regulation of mt:ATPase6?

Research on yeast mitochondrial ATP synthase has uncovered a sophisticated regulatory relationship between ATP synthase assembly and the translation of its component subunits. While specific data for Drosophila simulans mt:ATPase6 is limited, studies in related systems have revealed important principles:

  • Assembly-dependent translation: Translation of subunits 6 and 9 is enhanced in mutant strains with specific defects in the assembly of these proteins, suggesting feedback mechanisms that couple protein production to complex assembly .

  • cis-regulatory elements: The 5′-UTR of ATP6 contains regulatory sequences that control gene expression in response to assembly status .

  • Assembly intermediates: Specific assembly intermediates interact with ATP6 within the final ATP synthase complex, potentially mediating translational feedback .

  • Assembly pathway discrepancies: Research contradicts some previously accepted models, such as the independent formation of the subunit 9 10-ring, suggesting more complex interdependencies in assembly .

  • Temporal regulation: Subunit 6 incorporation occurs late in the ATP synthase assembly process, which may explain why assembly defects trigger enhanced translation of this subunit .

What approaches can be used to express and purify recombinant Drosophila simulans mt:ATPase6?

Successful expression and purification of recombinant Drosophila simulans mt:ATPase6 requires careful optimization due to its hydrophobic nature as a membrane protein. Based on established protocols, the following methodological approach is recommended:

Expression System:

  • E. coli is the preferred expression system, with BL21(DE3) strains commonly used .

  • Expression vectors should include an N-terminal His-tag for purification.

  • Codon optimization may improve expression efficiency in E. coli.

Induction Conditions:

  • Lower temperatures (16-20°C) often improve folding of membrane proteins.

  • Reduced IPTG concentrations (0.1-0.5 mM) and extended expression times (overnight) may increase yield of properly folded protein.

Purification Protocol:

  • Cell lysis using methods that effectively solubilize membrane proteins (detergents, pressure-based lysis).

  • Solubilization of membrane fraction using appropriate detergents (DDM, LDAO, or Triton X-100).

  • Ni-NTA affinity chromatography using buffers containing detergent.

  • Optional: Size exclusion chromatography to improve purity.

Storage and Handling:

  • Store as lyophilized powder or in solution with 50% glycerol at -20°C/-80°C .

  • Avoid repeated freeze-thaw cycles.

  • Reconstitute in appropriate buffer (Tris/PBS-based, pH 8.0) with 6% trehalose .

Quality Control:

  • Verify purity by SDS-PAGE (should exceed 90%) .

  • Confirm identity by mass spectrometry or western blotting.

  • Assess functional integrity through ATP hydrolysis assays if applicable.

How can researchers establish Drosophila disease models for studying mt:ATPase6 mutations?

Creating effective Drosophila disease models for studying mt:ATPase6 mutations requires specialized genetic approaches due to the mitochondrial genomic location of this gene. Based on successful research strategies, the following methodological framework is recommended:

Approach 1: P-element and EMS Mutagenesis

  • Generate mutations using P-element insertion or EMS (ethyl methanesulfonate) mutagenesis .

  • Screen for phenotypes including developmental delay, early adult lethality, locomotor defects, and sterility .

  • Verify mutations through sequencing and quantify heteroplasmy levels.

Approach 2: Mitochondrial Transformation

  • Construct plasmids containing wild-type or mutated ATP6 genes flanked by appropriate regulatory elements .

  • Introduce constructs into mitochondria of ρ⁰ strains using biolistic transformation .

  • Confirm successful transformation through genetic crosses and functional analysis.

Phenotypic Characterization:

  • Assess developmental timing, lifespan, motor function, and fertility .

  • Examine tissue-specific effects, particularly in high-energy tissues like muscles and neurons .

  • Monitor behavior using standardized assays (climbing assays, courtship behavior) .

Functional Analysis:

  • Measure ATP production using luciferase-based assays.

  • Assess mitochondrial morphology through electron microscopy .

  • Quantify mitochondrial membrane potential using fluorescent indicators.

  • Analyze oxidative phosphorylation complexes using blue native PAGE .

Molecular Characterization:

  • Quantify mRNA expression using qRT-PCR with primers such as:
    qRT_ATPsynC_Up: 5'-GCCGCAACAGTCGGTGTC-3'
    qRT_ATPsynC_Lw: 5'-AGGCGAACAGCAGCAGGAA-3'

  • Monitor ROS production using MitoSOX or related indicators .

  • Assess mtDNA copy number using qPCR or PicoGreen staining .

What methods can be used to assess the functional impact of mt:ATPase6 mutations?

Comprehensive functional analysis of mt:ATPase6 mutations requires multiple complementary approaches to evaluate bioenergetic, structural, and physiological consequences. The following methodological framework enables thorough characterization:

Bioenergetic Analysis:

  • ATP Production Measurement:

    • Luciferase-based ATP assays to quantify cellular ATP levels.

    • Real-time ATP production monitoring using genetically encoded sensors.

  • Respiratory Chain Function:

    • Oxygen consumption rate (OCR) measurement using respirometry.

    • NAD+/NADH ratio quantification to assess redox state shifts .

    • Analysis of respiratory complex activities using spectrophotometric assays.

Structural Assessment:

  • Mitochondrial Morphology:

    • Electron microscopy to identify ultrastructural defects in the mitochondrial inner membrane .

    • Fluorescence microscopy with mitochondrial markers to assess network dynamics.

  • ATP Synthase Assembly:

    • Blue native PAGE to analyze intact ATP synthase complexes and assembly intermediates.

    • Immunoprecipitation to study protein-protein interactions within the complex.

Cellular Responses:

  • ROS Production:

    • Fluorescent indicators (DCF-DA, MitoSOX) to measure mitochondrial ROS levels .

    • Antioxidant enzyme activity assays to assess cellular response to oxidative stress.

  • Mitochondrial Quality Control:

    • Analysis of mitochondrial turnover pathways through fluorescent reporters.

    • Assessment of mitophagy markers and flux analysis.

Organismal Phenotypes:

  • Neuromuscular Function:

    • Locomotor assays (climbing, flight ability) to quantify movement disorders .

    • Electrophysiological measurements of neural function .

  • Developmental Effects:

    • Developmental timing analysis across life stages .

    • Tissue-specific phenotypic characterization, particularly in high-energy tissues.

  • Lifespan Analysis:

    • Survival curves under various environmental stresses.

    • Age-dependent phenotype progression assessment .

The combination of these approaches allows researchers to establish clear relationships between specific mt:ATPase6 mutations, ATP synthase dysfunction, and resulting cellular and organismal phenotypes.

How can researchers utilize genetic screens to identify modifiers of ATP synthase function?

Genetic screening approaches offer powerful tools for identifying novel factors that influence ATP synthase function and potential therapeutic targets. Based on successful approaches in Drosophila, the following methodological strategies are recommended:

RNAi-Based Screens:

  • High-Throughput RNAi Screening:

    • Use S2 cells or in vivo RNAi to systematically knockdown candidate genes .

    • Employ fluorescent markers like PicoGreen to visualize mtDNA nucleoids .

    • Quantify phenotypes such as mtDNA copy number, ATP levels, or mitochondrial morphology.

  • Targeted Pathway Analysis:

    • Focus RNAi on specific pathways (e.g., mitochondrial dynamics, translation, or quality control).

    • Combine with reporters for ATP production or ROS levels to assess functional outcomes.

Genetic Interaction Screens:

  • Enhancer/Suppressor Screens:

    • Cross ATP synthase mutants with deficiency lines or specific gene mutations.

    • Identify genes that enhance or suppress ATP synthase-related phenotypes.

    • Classify modifiers based on their functional categories to identify key pathways.

  • Synthetic Lethality Approaches:

    • Identify genes that, when mutated, cause lethality specifically in ATP synthase-compromised backgrounds.

    • Focus on viable mutant combinations with strong phenotypic enhancements.

Functional Validation:

  • Secondary Assays:

    • Confirm hits with multiple RNAi constructs to rule out off-target effects.

    • Validate using complementary approaches (CRISPR/Cas9 mutations, overexpression).

  • Mechanistic Studies:

    • Characterize physical interactions between modifiers and ATP synthase components.

    • Assess effects on ATP synthase assembly, activity, or regulation.

Data Analysis Framework:

Screening ApproachPrimary ReadoutSecondary ValidationSuccess Rate
Genome-wide RNAimtDNA nucleoid fluorescenceqPCR for mtDNA copy number~1-2% positive hits
ATP level screenLuciferase-based ATP assayRespirometryVariable by genetic background
Lifespan modificationSurvival curve analysisTissue-specific driversTypically 5-10% validation

Through these approaches, researchers have successfully identified unexpected connections between ATP synthase function and other cellular processes, including proteasome activity, cytosolic translation, and mitochondrial quality control mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.