Recombinant Drosophila simulans Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890)

Shipped with Ice Packs
In Stock

Description

Functional Role in V-ATPase Assembly

VMA21 proteins are essential chaperones for the assembly of the V₀ domain of V-ATPases, which is required for proton transport. In Drosophila simulans, GD14890 facilitates:

  • Proteolipid Ring Assembly: Binds subunit c′ to promote the organization of proteolipid subunits into a ring structure .

  • V₀ Domain Maturation: Collaborates with other chaperones (e.g., Vma12p, Vma22p) to integrate subunit a into the V₀ domain .

  • ER-to-Golgi Transport: Escorts the assembled V₀ domain to the Golgi for fusion with the V₁ ATPase sector .

Mutations in VMA21 homologs (e.g., human VMA21) impair V₀ assembly, leading to lysosomal deacidification, defective autophagy, and diseases like X-linked Myopathy with Excessive Autophagy (XMEA) .

Functional Studies

Recombinant GD14890 is used to study V-ATPase biogenesis and disease mechanisms:

  • Yeast Complementation Assays: Human VMA21 variants (e.g., R18G, D63G) reduce yeast growth in high-zinc conditions, indicating impaired proton pumping .

  • Fibroblast Models: Overexpression of GD14890 homologs in human cells rescues V₀ subunit expression (e.g., ATP6V0C) and lysosomal acidification defects .

  • Cancer Research: VMA21 overexpression suppresses colorectal cancer (CRC) cell proliferation in vitro and in xenograft models, suggesting a tumor-suppressive role .

Comparison with Other VMA21 Orthologs

SpeciesGene NameKey FeatureV-ATPase RoleDisease Relevance
D. simulansGD14890Partial/full-length, His-taggedProteolipid ring assemblyModel for XMEA and CDG studies
D. melanogasterCG5969Cell-free expression, uncharacterizedER-dependent V₀ assemblyNot reported
Homo sapiensATP6V0E1Full-length, lacks ER retrieval motifV₀-V₁ fusion, lysosomal acidificationXMEA, congenital disorders of glycosylation (CDG)

Applications

  • SDS-PAGE: Verify purity and molecular weight (e.g., ~12 kDa for full-length) .

  • Western Blot: Detect interactions with V₀ subunits (e.g., ATP6V0C) or chaperones (e.g., ATP6AP2) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GD14890; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Drosophila simulans (Fruit fly)
Target Names
GD14890
Target Protein Sequence
MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Drosophila simulans VMA21 protein?

Drosophila simulans VMA21 (GD14890) is a 105-amino acid integral membrane protein that functions as an assembly factor for V-ATPase. Based on homology with human VMA21, it likely contains transmembrane domains that anchor it in the endoplasmic reticulum (ER) membrane. The protein structure facilitates interaction with V-ATPase V₀ domain components during assembly . To experimentally analyze VMA21 structure, researchers should employ topology prediction software followed by validation through epitope tagging at various positions to map membrane orientation.

How does VMA21 participate in V-ATPase assembly?

VMA21 functions primarily in the early stages of V-ATPase assembly within the ER. It specifically assists in the assembly of the V₀ domain by facilitating proper folding and association of V₀ subunits. When VMA21 is deficient, V₀ subunit expression is reduced (notably ATP6V0D1 and ATP6V0C), indicating impaired V₀ assembly . To investigate this process, researchers can employ co-immunoprecipitation studies with V₀ subunits and monitor assembly intermediates through glycerol gradient centrifugation.

What expression systems are suitable for producing recombinant Drosophila simulans VMA21?

The recombinant full-length Drosophila simulans VMA21 protein has been successfully expressed in E. coli with an N-terminal His-tag . For optimal expression, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coli (BL21, Rosetta)High yield, cost-effectiveMay require lower temperature (16-20°C) for proper folding
Insect cells (Sf9, S2)Better for membrane proteinsHigher cost, longer expression time
Cell-free systemsAvoids toxicity issuesLimited scale, expensive

For E. coli expression, induction with 0.1-0.5 mM IPTG at reduced temperatures (16-25°C) for 16-18 hours typically maximizes protein yield while minimizing inclusion body formation.

What purification strategy yields the highest quality recombinant VMA21?

For membrane proteins like VMA21, a multi-step purification approach is essential:

  • Membrane fraction isolation: Lyse cells and isolate membranes through differential centrifugation

  • Solubilization: Use mild detergents (DDM, CHAPS) to extract VMA21 while preserving structure

  • IMAC purification: Apply to Ni-NTA resin using appropriate buffers (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, detergent, 10-20 mM imidazole; elute with 250-300 mM imidazole)

  • Size exclusion chromatography: Remove aggregates and isolate properly folded protein

  • Quality control: Assess purity by SDS-PAGE and functionality through binding assays with V₀ components

How does Drosophila simulans VMA21 compare with human VMA21?

While functionally similar, key differences exist between Drosophila and human VMA21:

FeatureDrosophila simulans VMA21Human VMA21
Size105 amino acids Typically 101 amino acids
C-terminal motifLacks ER retrieval motifLacks C-terminal dilysine motif (KK) present in yeast
Disease associationNot well-characterizedMutations cause XMEA and VMA21-CDG

These differences may influence their specific interaction patterns with V-ATPase components. To experimentally compare their functions, researchers can perform cross-species complementation studies in yeast or knockout cell lines.

Can Drosophila VMA21 functionally replace human VMA21 in experimental models?

  • Generate human cell lines with VMA21 knockout using CRISPR/Cas9

  • Express Drosophila simulans VMA21 in these cells

  • Assess rescue of phenotypes including:

    • V-ATPase assembly (co-IP and BN-PAGE)

    • Lysosomal acidification (LysoSensor assays)

    • Cathepsin activity

    • Autophagic flux (LC3-II/LC3-I ratio)

How does VMA21 deficiency affect lysosomal function?

VMA21 deficiency impairs V-ATPase assembly, leading to several measurable consequences:

To assess these parameters, researchers should employ live-cell imaging with pH-sensitive dyes and activity-based probes for lysosomal enzymes.

What is the relationship between VMA21 function and lipid metabolism?

VMA21 deficiency affects lipid metabolism through several mechanisms:

  • Impaired lipophagy: Defective lysosomal degradation leads to accumulation of lipid droplets in autolysosomes

  • Cholesterol dysregulation: VMA21 deficiency triggers ER stress and sequestration of unesterified cholesterol in lysosomes, activating SREBP-mediated cholesterol synthesis pathways

  • Hepatic steatosis: In human patients with VMA21 mutations, steatosis in hepatocytes has been observed

Researchers can investigate these aspects using fluorescent lipid dyes (BODIPY, Oil Red O) and lipidomic analysis of VMA21-deficient cells.

How can Drosophila models inform our understanding of human VMA21-associated diseases?

Drosophila VMA21 models can provide valuable insights into human diseases like X-linked myopathy with excessive autophagy (XMEA) and VMA21-CDG. Researchers should:

  • Generate VMA21 knockdown or knockout Drosophila lines

  • Assess tissue-specific phenotypes:

    • Muscle: Histology, contractile function, and ultrastructure

    • Liver analogs (fat body): Lipid accumulation and glycosylation defects

    • Lysosomal function: Autophagy markers and pH sensitive probes

  • Perform rescue experiments with wild-type or mutant human VMA21

  • Screen for genetic modifiers that exacerbate or ameliorate phenotypes

These models are particularly valuable for high-throughput screening of potential therapeutic compounds.

What are the functional consequences of specific VMA21 mutations?

Different VMA21 mutations produce distinct functional defects:

Mutation TypeEffect on VMA21Functional Consequences
Missense (e.g., p.Asp63Gly)Reduced mRNA/protein levels; altered protein interactionsImpaired V-ATPase assembly with milder phenotype
5' UTR variants (e.g., c.-10C>T)Creates new initiation codon leading to frameshiftStrongly reduced mRNA/protein levels, severe phenotype
Splice site mutationsAlternative transcripts with premature stop codonsStrongly reduced functional protein, severe phenotype

To investigate these consequences, researchers should express mutant variants in cell models and assess protein stability, interaction with V₀ components, and functional rescue in VMA21-deficient backgrounds.

How can VMA21-V₀ interactions be leveraged for structural biology studies?

The specific interactions between VMA21 and V₀ components make them ideal candidates for structural studies:

  • Cryo-EM analysis of VMA21-V₀ assembly intermediates can reveal the structural basis of assembly

  • Crosslinking mass spectrometry (XL-MS) using photo-activatable or chemical crosslinkers can map interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of VMA21 that become protected upon binding to V₀ components

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy can measure distances between specific residues

These approaches would significantly advance our understanding of V-ATPase assembly mechanisms.

What experimental approaches can assess the kinetics of VMA21-mediated V-ATPase assembly?

To study assembly kinetics, researchers should consider:

  • Real-time binding assays using surface plasmon resonance (SPR) or bio-layer interferometry (BLI) with purified components

  • Fluorescence-based approaches:

    • FRET pairs on VMA21 and V₀ components to monitor association in real-time

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion properties of assembly intermediates

  • Time-resolved cryo-EM to capture assembly intermediates at different stages

  • Pulse-chase experiments with radiolabeled or photoactivatable amino acids to track assembly progression

These methods would help determine the rate-limiting steps in V-ATPase assembly and identify potential regulatory points.

How is VMA21 expression regulated in different tissues and developmental stages?

While specific data for Drosophila simulans VMA21 regulation is limited, researchers should investigate:

  • Transcriptional regulation: Identify promoter elements and transcription factors controlling VMA21 expression

  • Post-transcriptional control: Assess mRNA stability and potential miRNA regulation

  • Tissue-specific expression patterns: Perform in situ hybridization or generate reporter lines

  • Developmental profiling: Quantify VMA21 levels across developmental stages

Understanding expression patterns may explain tissue-specific sensitivities to VMA21 deficiency observed in human patients, particularly affecting liver and muscle tissues .

What is the potential role of VMA21 under cellular stress conditions?

VMA21 may serve as a regulatory point for V-ATPase assembly during stress conditions. Researchers should:

  • Expose cells to various stressors (oxidative, ER, nutrient deprivation) and monitor VMA21:

    • Expression levels (qPCR, Western blot)

    • Subcellular localization (immunofluorescence)

    • Post-translational modifications (phosphoproteomics)

    • Protein-protein interactions (co-IP under stress conditions)

  • Assess V-ATPase assembly and function under stress in wild-type vs. VMA21-deficient cells

  • Determine if VMA21 overexpression can protect against specific stress-induced phenotypes

This research direction may reveal novel roles for VMA21 beyond its canonical assembly function.

What are the optimal buffer conditions for maintaining recombinant VMA21 stability?

As a membrane protein, VMA21 requires careful handling:

Buffer ComponentRecommended RangeRationale
pH7.0-8.0Mimics ER environment
Salt150-300 mM NaClStabilizes hydrophobic interactions
Detergent0.03-0.1% DDM or 0.5-1% CHAPSMaintains solubility without denaturation
Glycerol5-10%Enhances stability during freeze-thaw
Reducing agent1-5 mM DTT or TCEPPrevents oxidation of cysteine residues

Stability should be monitored through size exclusion chromatography profiles and thermal shift assays to optimize conditions for specific applications.

What control experiments are essential when studying VMA21 function?

Rigorous controls are crucial for VMA21 research:

  • Expression controls:

    • Rescue experiments with wild-type VMA21 in knockdown/knockout systems

    • Inactive VMA21 mutants as negative controls

  • Functional assays:

    • Bafilomycin A1 treatment as positive control for V-ATPase inhibition

    • pH calibration curves for lysosomal acidification assays

  • Interaction studies:

    • Detergent-only controls for membrane protein co-IP

    • Competition assays with excess untagged protein

  • Complementation studies:

    • Species-specific controls when testing cross-species functionality

These controls ensure reliable interpretation of results in this complex system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.