Recombinant Drosophila subobscura Cytochrome b (mt:Cyt-b)

Shipped with Ice Packs
In Stock

Description

Introduction to Drosophila subobscura Cytochrome b

Drosophila subobscura is a widely studied member of the Drosophila obscura species group, commonly known as fruit flies. This species has gained significant attention in genetic and evolutionary studies due to its rich chromosomal inversion polymorphism and widespread European distribution . Cytochrome b (mt:Cyt-b) is a mitochondrially encoded protein that plays a crucial role in cellular respiration as part of the cytochrome bc1 complex (Complex III) in the electron transport chain.

The recombinant form of Drosophila subobscura Cytochrome b provides researchers with a purified version of this protein that can be used for various experimental applications. The recombinant protein is typically produced by expressing the gene in a bacterial system, such as Escherichia coli, followed by purification processes that yield the protein in a form suitable for research purposes .

Cytochrome b is particularly valuable in evolutionary studies as it exhibits sufficient conservation to maintain its functional role while displaying enough variability to serve as a molecular marker for phylogenetic analyses. The mitochondrial cytochrome b gene has been extensively used in studies examining the evolutionary relationships within the Drosophila obscura species group, contributing significantly to our understanding of speciation and genetic differentiation .

Expression Systems and Methodology

The recombinant Drosophila subobscura Cytochrome b protein is typically expressed in Escherichia coli expression systems, which provide an efficient platform for producing substantial quantities of the protein. The process involves cloning the full-length cytochrome b gene (covering amino acids 1-166) into a suitable expression vector that incorporates an N-terminal histidine tag for subsequent purification .

The expression system is designed to ensure the proper folding and stability of the recombinant protein. While native cytochrome b in Drosophila is membrane-bound and contains two heme b cofactors (heme bL and bH) non-covalently bound by conserved histidine residues , the recombinant version may differ in certain structural aspects due to the expression environment and the addition of tags.

Purification and Quality Control

Following expression in E. coli, the recombinant protein undergoes purification processes, typically involving affinity chromatography utilizing the N-terminal histidine tag. The purified protein is then subjected to quality control assessments, including SDS-PAGE analysis to confirm purity, which typically exceeds 90% for commercial preparations .

The final product is generally provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which enhances stability during storage. The protein requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use, and the addition of glycerol (typically to a final concentration of 50%) is recommended for long-term storage .

Role in the Electron Transport Chain

Cytochrome b serves as a critical component of the cytochrome bc1 complex (Complex III) in the mitochondrial electron transport chain. In this capacity, it plays an essential role in cellular respiration by facilitating the transfer of electrons and contributing to the generation of the proton gradient necessary for ATP synthesis .

The protein contains two heme b cofactors, designated heme bL (located close to the intermembrane space side of the inner membrane) and heme bH (positioned near the matrix surface). These hemes are non-covalently bound by conserved histidine residues in the second and fourth transmembrane helices, with additional structural stability provided by conserved glycines and hydrogen bond contacts in the first and third helices .

Assembly and Integration into Complex III

The assembly of cytochrome b into the functional cytochrome bc1 complex involves a coordinated process that ensures proper integration with other subunits. In eukaryotes, cytochrome b is the sole component of the bc1 complex encoded by the mitochondrial genome, while the remaining subunits are nuclear-encoded .

The synthesis and integration of cytochrome b serve as a nucleating event for the assembly of the entire complex. The newly synthesized cytochrome b forms an assembly intermediate that stabilizes the protein while it receives its heme cofactors and establishes interactions with additional complex subunits. This intermediate likely includes assembly factors such as Cbp3, Cbp6, and Cbp4, which aid in the proper folding and integration of cytochrome b .

Phylogenetic and Evolutionary Studies

Recombinant Drosophila subobscura Cytochrome b has significant applications in phylogenetic and evolutionary studies. The cytochrome b gene serves as a valuable marker for investigating evolutionary relationships within the Drosophila obscura species group, contributing to our understanding of speciation processes and genetic differentiation .

Studies leveraging cytochrome b sequence analysis have helped establish branching orders within the Drosophila obscura species group, including the positioning of the subobscura subgroup as basal to many other ingroup species. These analyses have provided insights into the evolutionary history and relationships among different Drosophila lineages .

Species Identification and Diagnostic Applications

The cytochrome b gene is particularly useful for species identification within the Drosophila genus, especially for distinguishing between morphologically similar species. For instance, Drosophila obscura and Drosophila subobscura, which are common in the United Kingdom and can be difficult to differentiate based on morphology alone, can be reliably distinguished using diagnostic PCR assays targeting the cytochrome b gene .

These diagnostic applications involve designing species-specific primers that anneal to different positions in the cytochrome b gene, resulting in PCR products of different sizes for different species. Under stringent PCR conditions, this approach enables accurate identification of Drosophila species, with cytochrome b-based assays yielding bands of different sizes for D. obscura (230 bp) and D. subobscura (575 bp) .

Reconstitution Protocols

When preparing the recombinant protein for use, proper reconstitution protocols should be followed. The vial containing the lyophilized protein should be briefly centrifuged to bring the contents to the bottom before opening. The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For long-term storage following reconstitution, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and to aliquot the solution before storing at -20°C or -80°C. This approach minimizes damage from freeze-thaw cycles and helps maintain protein stability over extended periods .

Table 1: Key Characteristics of Recombinant Drosophila subobscura Cytochrome b

ParameterSpecification
SpeciesDrosophila subobscura (Fruit fly)
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-166 amino acids)
FormLyophilized powder
UniProt IDP51941
Purity>90% (SDS-PAGE)
ApplicationsSDS-PAGE, Phylogenetic studies
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Temperature-20°C to -80°C

Ongoing Studies

Current research involving Drosophila subobscura Cytochrome b encompasses various areas, including detailed analyses of mitochondrial DNA variation across European populations. These studies provide insights into population genetics, evolutionary dynamics, and the impact of chromosomal inversion polymorphisms on genetic variability .

Research has revealed that Drosophila species, including D. subobscura, exhibit varying levels of mitochondrial DNA variation, with implications for understanding evolutionary processes and population dynamics. The study of cytochrome b variation contributes to broader investigations of genetic structure and differentiation among Drosophila populations .

Future Research Potential

Future research directions involving recombinant Drosophila subobscura Cytochrome b may include:

  1. More detailed structural analyses to elucidate the specific conformational properties of the protein and how they relate to function

  2. Investigation of species-specific variations in cytochrome b and their functional significance

  3. Development of more sophisticated diagnostic tools based on cytochrome b for species identification

  4. Exploration of the potential role of cytochrome b variations in adaptation to different environmental conditions

These research avenues would contribute to a deeper understanding of mitochondrial function, evolutionary processes, and species differentiation within the Drosophila genus, with potential implications for broader biological questions related to energy metabolism and molecular evolution.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:Cyt-b; Cob; cytb; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Drosophila subobscura (Fruit fly)
Target Names
mt:Cyt-b
Target Protein Sequence
NSNIDKIPFHPYFTFKDIVGFIVMIFLLISLVLINPNLLGDPDNFIPANPLVTPAHIQPE WYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQILFWIMLVT VILLTWIGARPVEEPYVLLGQILTVIYFLYYLINPLVSKWWDNLLN
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), a crucial part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and genetic organization of mt:Cyt-b in Drosophila subobscura?

Drosophila subobscura Cytochrome b (mt:Cyt-b) is encoded within the mitochondrial genome, which has been completely sequenced and is approximately 15,764-15,900 bp in length . The mt:Cyt-b gene is part of the conserved mitochondrial protein-coding regions and is involved in the electron transport chain as a component of respiratory complex III (the bc1 complex).

The mitochondrial genome of D. subobscura shows the ancestral Drosophila karyotype structure, with the gene arrangement exhibiting conservation with related species while maintaining species-specific variations that enable molecular diagnostics . The complete sequencing of the D. subobscura mitogenome revealed important structural features that have aided in understanding the evolutionary relationships within the subobscura subgroup.

Mitochondrial Genome Size Comparison:

SpeciesMitochondrial Genome Size (bp)Reference
D. subobscura15,764-15,900
D. yakuba~16,000 (comparative reference)

How can researchers use mt:Cyt-b as a molecular marker to distinguish between Drosophila subobscura and closely related species?

The mt:Cyt-b gene provides excellent diagnostic capabilities for distinguishing D. subobscura from morphologically similar species, particularly D. obscura. Researchers have developed a precise PCR-based molecular method using species-specific primers that target single nucleotide differences in the mt:Cyt-b sequence .

Methodological approach:

  • Extract RNA from specimens using Trizol reagent in a chloroform-isopropanol extraction

  • Reverse transcribe RNA with M-MLV reverse transcriptase using random hexamer primers

  • Design diagnostic PCR primers targeting the mt:Cyt-b gene:

    • Use a conserved forward primer

    • Design species-specific reverse primers by placing the 3′ end on species-specific single nucleotide differences

    • Create primer sets that produce different-sized PCR products for each species

Using this approach, researchers can distinguish D. subobscura from D. obscura with high specificity, as the mt:Cyt-b PCR assay produces bands of 575 bp for D. subobscura and 230 bp for D. obscura .

What techniques are most effective for extracting and analyzing mt:Cyt-b from D. subobscura for population genetic studies?

For population genetic studies of D. subobscura using mt:Cyt-b, researchers have employed several effective methodologies:

Extraction and processing:

  • Collect and establish isofemale lines from diverse populations

  • Extract mitochondrial DNA using chloroform-isopropanol protocols

  • Use restriction endonuclease analysis for detecting polymorphisms

  • Amplify mt:Cyt-b using species-specific primers

  • Sequence the amplified products for detailed analysis

In a comprehensive study, researchers analyzed 261 isofemale lines using 11 restriction endonucleases with 38 different cleavage sites in the mtDNA map . This approach revealed 24 distinct nucleomorphs, demonstrating the power of mt:Cyt-b analysis for population studies.

Statistical analysis approaches:

  • Calculate nucleotide diversity (π) between populations

  • Measure genetic differentiation between populations (δ)

  • Construct phylogenetic relationships based on mtDNA variation

  • Map geographic distribution of mt:Cyt-b haplotypes

The average nucleotide diversity (π) for D. subobscura was found to be approximately 0.008, which is comparable to estimates for other Drosophila species that typically range from 0.002 to 0.011 .

How does mt:Cyt-b sequence variation correlate with geographic population structure in D. subobscura?

Mt:Cyt-b sequence variation has revealed significant insights into the geographic population structure of D. subobscura. Analysis of mtDNA polymorphism across Palearctic populations demonstrated striking differences in genetic differentiation between insular and continental populations .

Key findings on population structure:

  • Canary Islands populations show remarkable differentiation (δ = 0.0119) compared to continental populations (δ = 0.0002)

  • High divergence exists among Canary Islands nucleomorphs (δ = 0.021)

  • Continental European populations exhibit relatively low differentiation

  • Distinct patterns of mtDNA variation correlate with geographical isolation and founder events

This research demonstrates that mt:Cyt-b is particularly sensitive to founder events and population subdivision, making it an excellent marker for studying population history and structure . The maternal inheritance and lack of recombination in mtDNA contribute to its effectiveness in revealing fine-scale population structure.

What are the critical functional domains in Cytochrome b that should be preserved when designing recombinant constructs?

When designing recombinant constructs of D. subobscura mt:Cyt-b, researchers must consider several critical functional domains:

Essential functional regions:

  • The C-terminal region is particularly critical for protein synthesis and bc1 complex assembly

  • Heme-binding domains are essential for electron transport functionality

  • The IEN sequence in the C-terminal region is highly conserved among fungi and mammals and likely plays a crucial role in function

Research on Cytochrome b has shown that truncation of the C-terminal region (specifically the last 13 amino acids containing the sequence IENVLFYIGRVNK) severely impairs both protein synthesis and assembly of the bc1 complex . This region is exposed to the mitochondrial matrix and contains highly conserved residues critical for proper function.

Additionally, mutations that affect the stability of early intermediates in complex assembly can severely impact the functional expression of recombinant mt:Cyt-b. The proper assembly pathway involves several chaperone proteins (Cbp3, Cbp6, Cbp4) that stabilize Cytochrome b during hemylation and complex formation .

How can mt:Cyt-b be integrated with chromosomal inversion data in evolutionary studies of D. subobscura?

D. subobscura exhibits extraordinary levels of chromosomal polymorphism with over 65 identified inversions representing approximately 83% of the species genome . Integrating mt:Cyt-b data with chromosomal inversion studies provides a powerful approach for understanding evolutionary processes:

Integration methodology:

  • Analyze mt:Cyt-b variation to establish maternal lineage patterns

  • Map chromosomal inversions using polytene chromosome preparations

  • Correlate mtDNA haplotypes with specific inversion arrangements

  • Compare rates of evolution between mtDNA and chromosomal inversions

  • Use mt:Cyt-b as an independent genetic marker to validate or challenge inversion-based phylogenies

Comparative inversion rates:

LineageRelative Inversion Fixation Rate
Continental D. subobscura10x higher
Oceanic-island endemics (D. guanche and D. madeirensis)Baseline

What methods are used for analyzing nucleotide diversity in mt:Cyt-b across D. subobscura populations?

Researchers employ several sophisticated methods to analyze nucleotide diversity in mt:Cyt-b across D. subobscura populations:

Analytical approaches:

  • Restriction fragment length polymorphism (RFLP) analysis using multiple restriction enzymes

  • Direct sequencing of PCR-amplified mt:Cyt-b

  • Construction of detailed restriction maps to identify nucleomorphs

  • Calculation of nucleotide diversity (π) as a measure of genetic variation

In a comprehensive study, researchers analyzed mtDNA using 11 restriction endonucleases that recognized 38 different sites, revealing 24 distinct nucleomorphs among 261 isofemale lines . The smallest fragment reliably detected was approximately 500 bp in typical screening programs, with higher resolution (~300 bp) achieved using specific enzymes like SacI .

Nucleotide diversity comparison:

StudySpeciesNucleotide Diversity (π)
Afonso et al.D. subobscura0.008
Latorre et al.D. subobscura (Old World strains)0.011
Other Drosophila studiesVarious Drosophila species0.002-0.011

This data demonstrates that D. subobscura mt:Cyt-b shows similar levels of diversity to other Drosophila species, providing a valuable comparative framework for evolutionary studies .

How can researchers design specific primers for PCR amplification and expression of mt:Cyt-b from D. subobscura?

Designing effective primers for PCR amplification and subsequent expression of mt:Cyt-b from D. subobscura requires careful consideration of several factors:

Primer design methodology:

  • Analyze available mt:Cyt-b sequences from D. subobscura and related species to identify conserved and variable regions

  • Design forward primers in conserved regions to ensure amplification

  • Place reverse primers to capture species-specific variations

  • For expression purposes, incorporate appropriate restriction sites for subsequent cloning

  • Consider codon optimization when expressing mitochondrial genes in heterologous systems

Researchers have successfully designed species-specific primers by placing the 3′ end of the primer on a species-specific single nucleotide difference and the penultimate 3′ base mismatching all other available species sequences . This strategy, combined with stringent PCR conditions, allows for highly specific amplification.

For example, in distinguishing D. subobscura from D. obscura, researchers designed primers that produced different-sized products (575 bp for D. subobscura vs. 230 bp for D. obscura) . A similar approach can be used to amplify the complete mt:Cyt-b gene for recombinant expression.

What role does mt:Cyt-b play in understanding mitochondrial complex assembly in Drosophila?

Cytochrome b plays a crucial role in the assembly and function of mitochondrial respiratory complex III (the bc1 complex), making it an important target for understanding mitochondrial bioenergetics:

Key roles in complex assembly:

  • The C-terminal region is essential for regulating Cytochrome b synthesis

  • This region is critical for the proper recruitment of assembly factors and other subunits

  • The assembly pathway involves sequential addition of proteins to form functional complexes

Studies have shown that in mutants lacking the C-terminal region of Cytochrome b, respiratory function is lost due to the absence of fully assembled bc1 complex . Complexome profiling has revealed the existence of aberrant early-stage subassemblies in such mutants.

The assembly pathway involves several chaperone proteins (Cbp3, Cbp6, Cbp4) that stabilize hemylated Cytochrome b, forming intermediate I. After addition of heme b, Cbp3 and Cbp6 are released, and subunits Qcr7 and Qcr8 are added to form intermediate II, which then associates with the Cor1/Cor2/Cytc subcomplex to continue the assembly pathway .

How is mt:Cyt-b used in studies of introgression and hybridization between D. subobscura and related species?

Mt:Cyt-b serves as an excellent marker for studying introgression and hybridization due to its maternal inheritance and lack of recombination:

Applications in introgression studies:

  • Identifying maternal lineages in hybrid populations

  • Detecting historical introgression events between species

  • Quantifying the extent of gene flow between populations

  • Assessing the directionality of hybridization

Researchers have studied introgression in the Drosophila subobscura subgroup, including relationships with D. madeirensis and D. guanche . The complete sequencing of the D. subobscura mitochondrial genome has facilitated these comparative studies by providing a reference for detecting introgressed mitochondrial sequences.

The mt:Cyt-b gene, when analyzed alongside nuclear markers, can reveal discordant patterns that suggest historical introgression. For instance, specimens may possess mt:Cyt-b haplotypes characteristic of one species but nuclear genotypes of another, indicating hybridization events.

The maternal inheritance pattern of mt:Cyt-b makes it particularly valuable for studying the direction of introgression, as it can reveal whether hybridization predominantly involves females of one species and males of another.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.