Recombinant Drosophila subobscura Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila subobscura Cytochrome c Oxidase Subunit 2 (mt:CoII)

Drosophila subobscura Cytochrome c Oxidase subunit 2 (mt:CoII) is a protein subunit of the cytochrome c oxidase complex, which is essential for cellular respiration in Drosophila subobscura . Cytochrome c oxidase (COX), also known as Complex IV, is a large transmembrane protein complex found in mitochondria and is the terminal enzyme in the electron transport chain . It catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing oxygen to water and using the energy released to pump protons across the inner mitochondrial membrane, contributing to the generation of ATP .

The mt:CoII subunit is encoded by the mitochondrial genome and is highly conserved across species, making it a useful marker in evolutionary and phylogenetic studies . Recombinant mt:CoII refers to the protein produced using recombinant DNA technology, where the gene encoding the subunit is cloned and expressed in a host organism to produce large quantities of the protein for research purposes.

Role in Phylogenetic Studies

The mt:CoII gene is frequently used in phylogenetic studies to infer evolutionary relationships among species, particularly within the Drosophila genus . Its utility arises from:

  • Sequence Conservation: The gene exhibits sufficient sequence conservation to allow for easy amplification using PCR and sequencing across different species .

  • Variable Regions: It contains variable regions that provide phylogenetic information, allowing differentiation between closely related species .

  • Mitochondrial Inheritance: As a mitochondrial gene, it is maternally inherited and does not undergo recombination, simplifying phylogenetic analyses .

Experimental Methods for Studying mt:CoII

Several experimental methods are employed to study mt:CoII, including:

  • PCR Amplification and Sequencing: The mt:CoII gene is amplified from genomic DNA using specific primers and sequenced to determine its nucleotide sequence .

    • For example, in one study, a 681bp fragment of the D. gallinae mitochondrial cytochrome c oxidase subunit I (COI) gene was amplified using the primers COI1Fyuw114 (5′-AGATCTTTAATTGAAGGGGG-3′) and COI1Ryuw114 (5′- AAGATCAAAGAATCGGTGG-3′) .

  • Phylogenetic Analysis: The resulting sequences are used to construct phylogenetic trees and infer evolutionary relationships .

  • Recombinant Expression: The mt:CoII gene is cloned into an expression vector and expressed in a host organism to produce recombinant protein for functional studies .

Research Findings and Data

The mt:CoII gene has been used to study the phylogeny and evolution of the Drosophila obscura species group . Key findings include:

  • Monophyletic Groupings: The D. affinis and D. pseudoobscura subgroups are monophyletic groupings based on mt:CoII sequences .

  • Phylogenetic Relationships: Phylogenetic analyses using mt:CoII sequences have revealed the relationships among species within the Drosophila obscura group, providing insights into their evolutionary history .

Adaptive Significance

Inversion polymorphisms in Drosophila subobscura, which can affect the expression and function of genes including mt:CoII, are thought to be adaptive responses to environmental changes . For example, populations from historically polluted areas show different responses to heavy metal contamination, suggesting that genetic variations, including those in mitochondrial genes, play a role in adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila subobscura (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMVMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNDIEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTIPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISDKVNS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase (COX) and what is its functional significance in Drosophila?

Cytochrome c oxidase (COX) represents the terminal enzyme in the mitochondrial electron transport chain, playing a crucial role in cellular respiration. In Drosophila species, COX catalyzes the transfer of electrons from cytochrome c to molecular oxygen, contributing to the establishment of the proton gradient necessary for ATP synthesis.

Research has demonstrated that proper COX function is essential for Drosophila development and survival. Studies with knock-out models have shown that defects in COX function can result in developmental delays, complete lethality, and arrest of larval development at the third instar stage. The significant decrease in levels of fully assembled COX and its activity in ccdc56 knock-out larvae emphasizes the critical nature of this enzyme complex .

Methodologically, COX activity can be assessed through various biochemical assays measuring electron transfer rates or oxygen consumption in isolated mitochondria or intact cells. Histochemical staining can also be employed to visualize the spatial distribution of COX activity across different tissues and developmental stages.

How is mt:CoII encoded and expressed in Drosophila models?

In Drosophila species, Cytochrome c oxidase subunit 2 (mt:CoII) is encoded by the mitochondrial genome (mtDNA). As a mitochondrially-encoded protein, mt:CoII exhibits maternal inheritance patterns and exists in multiple copies per cell due to the polyploid nature of mitochondrial DNA.

Research techniques for studying mt:CoII expression include:

  • Rapid Amplification of cDNA Ends (RACE) for identifying transcript boundaries and structure

  • Northern blotting for detecting specific transcripts and confirming transcript size

  • RT-PCR for analyzing expression levels across developmental stages and tissues

  • Western blotting for detecting protein levels using specific antibodies

Experimental evidence from studies of mitochondrial gene expression in Drosophila has demonstrated that mitochondrial transcripts can exhibit complex processing patterns. For example, research has identified bicistronic transcripts containing both CCDC56 and mtTFB1 in Drosophila melanogaster, suggesting similar complex transcriptional patterns might exist for mt:CoII .

What are the optimal methodological approaches for generating recombinant mt:CoII for functional studies?

Generating functional recombinant mt:CoII requires careful consideration of expression systems and protein folding requirements. Based on established protocols for mitochondrial proteins, the following methodological approaches are recommended:

Expression Systems:

  • Bacterial expression (E. coli) with solubility enhancers for structural studies

  • Baculovirus expression in insect cells for improved folding

  • Drosophila S2 cells for native-like post-translational modifications

  • In vivo expression using the UAS-GAL4 system for tissue-specific studies

Critical Technical Considerations:

  • Inclusion of N-terminal mitochondrial targeting sequences

  • Codon optimization for the expression system

  • Affinity tags positioned to avoid interference with function

  • Detergent selection for membrane protein solubilization

  • Validation of proper folding and assembly into the COX complex

Research with Drosophila COX has demonstrated that expression of individual subunits must be validated by assessing functional integration into the complex. In studies of CCDC56 (a COX assembly factor), reintroduction of wild-type UAS-ccdc56 transgenes partially rescued the lethal phenotype and COX deficiency, providing a model for similar functional validation of recombinant mt:CoII .

How can researchers distinguish between COX deficiency caused by mt:CoII mutations versus assembly factor defects?

Distinguishing between primary mt:CoII defects and secondary COX deficiency due to assembly factor dysfunction requires systematic comparative analysis. Based on established research protocols, the following approaches provide differential diagnosis:

Experimental Strategy:

Analytical Approachmt:CoII Mutation IndicatorAssembly Factor Defect Indicator
Blue Native PAGESpecific reduction in fully assembled COXAccumulation of assembly intermediates
Protein stability assaysDecreased stability of mt:CoII onlyMultiple subunits affected
Complementation studiesRescue with wild-type mt:CoIIRescue with specific assembly factor
Transcriptional analysisNormal mt:CoII transcript levelsVariable effects on multiple transcripts

Research has shown that defects in COX assembly factors like CCDC56 result in significantly decreased levels of fully assembled COX and dramatic reduction in enzymatic activity. The lethal phenotype and COX deficiency in ccdc56 knock-out larvae could be partially rescued by reintroduction of a wild-type transgene, demonstrating the approach for distinguishing primary from secondary defects .

What experimental approaches can effectively measure the impact of mt:CoII variants on COX assembly and function?

Assessing the functional consequences of mt:CoII variants requires multi-level analysis from molecular interactions to organismal phenotypes. Based on established research methodologies, the following integrated approach is recommended:

Molecular-Level Analysis:

  • Site-directed mutagenesis to introduce specific variants

  • Blue Native PAGE to assess complex assembly

  • In vitro enzyme activity assays measuring electron transfer rates

  • Protein-protein interaction studies to evaluate subunit associations

Cellular/Tissue Analysis:

  • Mitochondrial membrane potential measurements

  • Oxygen consumption rate determination

  • ROS production quantification

  • mtDNA copy number assessment

Organismal Phenotypes:

  • Developmental timing analysis

  • Lifespan determination

  • Stress resistance evaluation

  • Tissue-specific functional assessments

Research with Drosophila COX mutants has demonstrated that even subtle impairments in COX function can dramatically impact development. Studies of ccdc56 knock-out larvae revealed developmental arrest at the third instar stage with decreased numbers of mitotic cells and increased apoptosis in wing discs, illustrating how COX deficiency affects fundamental cellular processes .

How do mutations in mt:CoII contribute to human mitochondrial disease pathogenesis, and can Drosophila models provide translational insights?

Mutations in MT-CO2 (the human homolog of mt:CoII) have been implicated in several mitochondrial disorders, with Drosophila models offering valuable translational insights. Research has demonstrated the following disease associations and experimental advantages:

Human MT-CO2 Mutation Disease Spectrum:

  • Late-onset progressive cerebellar ataxia

  • Mild hearing deficits

  • Myopathy and lactic acidosis

  • Rhabdomyolysis

  • Encephalomyopathy

A documented case study describes an adult patient who presented with late-onset progressive cerebellar ataxia and mild hearing loss at age 52, attributed to a novel heteroplasmic variant (m.8163A>G) in MT-CO2 . Muscle biopsy revealed marked COX deficiency, demonstrating the diagnostic value of enzymatic analysis.

Translational Value of Drosophila Models:

  • Genetic manipulability for introducing equivalent mutations

  • Rapid generation time for studying disease progression

  • Tissue-specific expression systems for modeling organ-specific effects

  • Conservation of COX structure and function across species

Drosophila research has highlighted the importance of considering mitochondrial genome sequencing in investigating adult-onset progressive cerebellar syndromes after excluding common acquired and genetic etiologies . This translational insight demonstrates how Drosophila models can inform human disease diagnosis and understanding.

What is the relationship between recombination rates and mt:CoII sequence evolution in Drosophila species?

Understanding the evolutionary dynamics of mt:CoII requires analysis of recombination patterns and selection pressures. Research in Drosophila has revealed important insights about mitochondrial gene evolution:

Recombination Analysis Approaches:

  • Direct experimental crosses with genetic markers

  • Population genetic analyses of linkage disequilibrium

  • Molecular evolutionary studies comparing divergence and diversity

Key Research Findings:
Recombination rate varies significantly across the Drosophila genome, with important implications for sequence evolution. Studies have demonstrated that nucleotide diversity correlates with recombination rate in Drosophila melanogaster, but a similar relationship with divergence to sister species (D. simulans) was not observed . This pattern suggests selection rather than mutation as the primary driver of this relationship.

Fine-scale mapping of recombination rates has revealed that recombination can be suppressed in regions spanning several megabases . This extensive recombination suppression can maintain linkage disequilibrium between adaptive variants, potentially affecting mitochondrial gene evolution through linked selection.

Experimental approaches for studying recombination involve controlled crosses with visible genetic markers and extensive backcrossing to isogenic stocks to minimize background genetic effects . These methodologies can be adapted to study mitochondrial sequence evolution.

How do epistatic interactions between mt:CoII and nuclear-encoded COX subunits influence mitochondrial function in Drosophila?

The interaction between mitochondrial-encoded mt:CoII and nuclear-encoded subunits represents a complex case of intergenomic epistasis with significant functional implications. Based on research findings, the following experimental approaches are recommended:

Experimental Strategies:

  • Cybrid cell lines combining different nuclear and mitochondrial genomes

  • Backcrossed lines with controlled nuclear backgrounds and variant mtDNA

  • Reciprocal crosses to distinguish maternal from nuclear effects

  • Gene replacement technologies for precise manipulation

Key Research Insights:
Research in Drosophila has demonstrated that strong epistatic selection is required to maintain linkage disequilibrium between variants in the face of recombination . This selection pressure preserves advantageous combinations of alleles, suggesting similar mechanisms may maintain optimal combinations of nuclear and mitochondrial variants affecting COX function.

Studies of segregation distortion in Drosophila pseudoobscura have shown that the combined action of suppressed recombination and strong selection can maintain genetic differentiation across inversions . Similar principles may apply to cytonuclear interactions, where selection would favor compatible combinations of nuclear and mitochondrial variants.

What experimental design considerations are necessary for accurately interpreting mt:CoII functional studies across different Drosophila species?

Cross-species studies of mt:CoII function require careful experimental design to control for genetic and environmental variables. Based on established research approaches, the following methodological considerations are essential:

Critical Experimental Controls:

Control FactorImplementation MethodRationale
Genetic backgroundMinimum 7 generations of backcrossingIsolates mt:CoII effects from other genetic influences
Environmental variablesStandardized temperature, humidity, and dietEliminates confounding environmental effects
Developmental timingAge-matching of samplesControls for temporal variation in gene expression
Tissue specificityPrecise tissue isolation protocolsAccounts for tissue-specific mt:CoII function
Technical variationConsistent protocols across speciesEnsures comparable data generation

Research has demonstrated the importance of extensive backcrossing (minimum seven generations) to control genetic background when studying specific genes in Drosophila . Additionally, careful isolation and maintenance of stock lines are essential for accurate cross-species comparisons, as illustrated by protocols for collecting and screening wild Drosophila flies from natural populations .

What are the most reliable techniques for isolating functional mitochondria from Drosophila for mt:CoII studies?

Isolating functional mitochondria from Drosophila tissues requires optimization of several key parameters. The following methodological approach represents current best practices:

Optimized Protocol Components:

  • Tissue selection: Flight muscles yield highest mitochondrial content

  • Homogenization buffer: pH 7.4 with added protease inhibitors

  • Differential centrifugation: Sequential spins to remove debris and isolate mitochondria

  • Density gradient purification: For highest purity preparations

  • Functional validation: Oxygen consumption and membrane potential measurements

Research has demonstrated that assessment of mitochondrial function, particularly COX activity, requires careful preparation to maintain functional integrity. Studies measuring COX activity in Drosophila have shown that isolation methods significantly impact measured enzyme activity, emphasizing the importance of standardized protocols .

How can researchers effectively design experiments to distinguish between pathogenic and benign variants in mt:CoII?

Distinguishing pathogenic from benign mt:CoII variants requires integrated computational and experimental approaches. Based on established methodologies, the following workflow is recommended:

Comprehensive Assessment Pipeline:

  • Computational prediction: Conservation analysis and structural modeling

  • Heterologous expression: Expression in COX-deficient cell lines

  • Enzymatic activity: Direct measurement of electron transfer rates

  • Complementation testing: Rescue of COX-deficient phenotypes

  • In vivo modeling: Generation of equivalent mutations in Drosophila

Research into mitochondrial disease has shown that pathogenic variants in MT-CO2 can cause isolated cytochrome c oxidase deficiency with variable clinical presentations . The identification of pathogenic variants often begins with muscle biopsy showing COX deficiency, followed by full mitochondrial genome sequencing. Similar approaches can be applied to distinguish functional variants in Drosophila mt:CoII.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.