Recombinant Drosophila subobscura NADH-ubiquinone oxidoreductase chain 3 (mt:ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:ND3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Drosophila subobscura (Fruit fly)
Target Names
mt:ND3
Target Protein Sequence
MLSIILIASLILTIVTIVMFLASILSKKALIDREKSSPFECGFDPKSSSRLPFSLRFFLI TIIFLIFDVEIALILPMIIIMKFSNIMIWTTTSIIFILILLIGLYHEWNQGMLNWSN
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of mt:ND3 in Drosophila subobscura?

NADH-ubiquinone oxidoreductase chain 3 (mt:ND3) is a mitochondrially encoded subunit of respiratory complex I that functions in the electron transport chain. In Drosophila subobscura, it consists of 117 amino acids with the sequence: mLSIILIASLILTIVTIVMFLASILSKKALIDREKSSPFECGFDPKSSSRLPFSLRFFLITIIFLIFDVEIALILPMIIIMKFSNIMIWTTTSIIFILILLIGLYHEWNQGmLNWSN .

Functionally, mt:ND3 contributes to the membrane domain of complex I, which is responsible for proton pumping across the inner mitochondrial membrane. This process creates an electrochemical gradient that drives ATP synthesis through oxidative phosphorylation. The protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane, where it interacts with other complex I subunits to facilitate electron transfer from NADH to ubiquinone .

The functional significance of mt:ND3 extends beyond its structural role, as variations in this protein have been linked to fitness effects that differ between sexes and nuclear genetic backgrounds in D. subobscura .

Which expression systems are most effective for recombinant mt:ND3 production?

Several expression systems can be used for producing recombinant mt:ND3, each with distinct advantages and limitations:

Expression SystemYieldTurnaround TimePost-translational ModificationsApplication Suitability
E. coliHighShortMinimalStructural studies
YeastGoodShort-MediumModerateSome functional studies
Insect cellsModerateMediumGoodFunctional studies
Mammalian cellsLowLongExcellentActivity retention

The choice of expression system should be based on the specific research goals. For structural studies or applications requiring large amounts of protein, bacterial systems may be preferable, while for functional assays that depend on native activity, eukaryotic expression systems are recommended despite their lower yields.

How should recombinant mt:ND3 be stored and handled?

Proper storage and handling of recombinant mt:ND3 is crucial for maintaining its structural integrity and functional properties. Based on standard protocols for similar proteins, the following guidelines are recommended:

For long-term storage, recombinant mt:ND3 should be kept at -20°C or -80°C in a buffer containing 50% glycerol to prevent freeze-thaw damage . The optimal buffer composition typically includes Tris-based buffer optimized specifically for this protein .

When working with the protein, it's advisable to:

  • Avoid repeated freeze-thaw cycles, as they can lead to protein denaturation and aggregation

  • Store working aliquots at 4°C for no more than one week

  • Handle the protein gently to avoid mechanical stress that could disrupt its structure

  • Use appropriate protease inhibitors to prevent degradation during experimental procedures

When designing experiments involving recombinant mt:ND3, careful consideration of these storage and handling guidelines will help ensure that functional and structural studies yield reliable and reproducible results.

How do different mtDNA haplotypes of mt:ND3 affect Drosophila fitness parameters?

Studies investigating the effects of different mtDNA haplotypes on fitness in Drosophila subobscura have revealed complex interactions between mitochondrial variation and nuclear background. Using mitonuclear introgression lines carrying different sympatric mtDNA haplotypes, researchers have assessed several key life-history traits:

Research has shown that the phenotypic effects of different mtDNA haplotypes (including those affecting mt:ND3) are contingent upon the nuclear genome with which they are co-expressed . This indicates that the fitness consequences of mt:ND3 variants cannot be evaluated in isolation from the nuclear genetic context.

Specifically, studies have demonstrated a significant mitonuclear genetic effect on adult sex ratio, suggesting that certain combinations of mitochondrial and nuclear genomes influence developmental success differently in males versus females . Additionally, researchers have identified a sex × mtDNA × nuDNA interaction for adult longevity, indicating that the same mtDNA variant can have different effects on lifespan depending on both the nuclear background and the sex of the individual .

These findings challenge the traditional view that mtDNA variation represents neutral evolution and suggest that selection on mitonuclear genotypes can maintain stable polymorphism within populations through sex-specific effects .

What experimental designs are most appropriate for studying mt:ND3 function?

Designing robust experiments to study mt:ND3 function requires careful consideration of several key principles:

  • Variable identification and control

    • Clearly define independent variables (e.g., mt:ND3 genetic variants) and dependent variables (e.g., respiratory complex activity, organism fitness)

    • Control extraneous variables such as temperature, diet, and density that might influence mitochondrial function

    • Consider possible confounding variables, particularly nuclear genetic background

  • Hypothesis formulation

    • Develop specific, testable hypotheses about mt:ND3 function

    • Ensure hypotheses address causal relationships rather than mere correlations

  • Experimental design selection

    • Between-subjects designs: Compare different groups each with a different mt:ND3 variant

    • Within-subjects designs: Measure the same subjects under different conditions (e.g., temperature, oxidative stress)

    • Factorial designs: Test how multiple factors interact with mt:ND3 variants

  • Subject assignment

    • Use random assignment when possible to minimize bias

    • Consider matched-pairs designs for controlling individual differences

    • For Drosophila studies, mitonuclear introgression lines allow controlled testing of specific mt:ND3 variants against standardized nuclear backgrounds

  • Measurement considerations

    • Develop reliable protocols for measuring complex I activity

    • Consider multiple fitness parameters (development time, lifespan, fecundity)

    • Include biochemical, physiological, and behavioral measures for comprehensive assessment

When designing experiments specifically for mt:ND3 in D. subobscura, researchers should pay particular attention to sex-specific effects, as these have been shown to be significant in this system .

How does mt:ND3 contribute to different conformational states of respiratory complex I?

Cryo-EM structural studies of mitochondrial respiratory complex I from Drosophila melanogaster have revealed important insights into the conformational dynamics of this large membrane protein complex, which likely apply to D. subobscura as well given the high conservation of complex I.

Research has identified three distinct conformational states of Drosophila complex I:

  • Dm1 (Active): The standard active conformation ready for catalysis

  • Dm2 (Twisted): Exhibits a global twist where hydrophilic and membrane domains twist in opposite directions when aligned on subunit ND1

  • Dm3 (Cracked): Shows more dramatic structural changes

The mt:ND3 subunit appears to contribute to these conformational changes through several key features:

These conformational changes are thought to be linked to the coupling mechanism between the ubiquinone-binding site and the proximal membrane domain, affecting how electron transfer is coupled to proton pumping . Understanding these conformational dynamics provides insights into the fundamental mechanisms of energy transduction in mitochondria.

What mechanisms underlie sex-specific mitonuclear epistasis involving mt:ND3?

Sex-specific mitonuclear epistasis involving mt:ND3 represents an intriguing aspect of mitochondrial genetics with significant evolutionary implications. Several potential mechanisms may explain this phenomenon:

  • Differential energy demands

    • Male and female reproductive tissues have different energy requirements

    • Sperm production is highly ATP-intensive and may be particularly sensitive to mitochondrial function

  • Hormonal regulation

    • Sex hormones can influence mitochondrial gene expression and function

    • Hormone-responsive elements may differentially affect nuclear-encoded complex I subunits

  • X-chromosome effects

    • Many nuclear-encoded mitochondrial proteins are on the X chromosome

    • Dosage compensation mechanisms may create different stoichiometric relationships in males vs. females

  • Mitochondrial quality control

    • Sex-specific differences in mitochondrial dynamics and quality control

    • Differential tolerance to suboptimal mitonuclear combinations

  • Evolutionary constraints

    • Sexual conflict over optimal mitochondrial function

    • "Mother's curse" phenomenon where maternal inheritance allows accumulation of male-harming mtDNA mutations

Research in D. subobscura has demonstrated both a significant mitonuclear genetic effect on adult sex ratio and a sex × mtDNA × nuDNA interaction for adult longevity . These findings suggest that the same mt:ND3 variant may have beneficial effects in one sex but neutral or even detrimental effects in the other, depending on the nuclear background.

This sex-specific mitonuclear selection likely contributes to the maintenance of mtDNA polymorphism and to mitonuclear linkage disequilibrium in natural populations , challenging the traditional view of neutral mtDNA evolution.

How can single-cell RNA sequencing approaches enhance mt:ND3 expression studies?

Single-cell RNA sequencing (scRNA-seq) offers powerful opportunities for studying mt:ND3 expression patterns with unprecedented resolution. Although mt:ND3 is encoded by mitochondrial DNA, its expression can be captured and analyzed through scRNA-seq approaches.

Recent scRNA-seq studies in Drosophila have demonstrated the feasibility of this technique for comprehensive cell population analysis and gene expression profiling . For mt:ND3 research, scRNA-seq can provide several advantages:

  • Cell type-specific expression patterns

    • Identification of cell types with differential mt:ND3 expression

    • Correlation with nuclear-encoded complex I subunits

    • Detection of cell populations particularly sensitive to mt:ND3 variants

  • Developmental trajectories

    • Tracking changes in mt:ND3 expression during differentiation

    • Identification of critical developmental stages for mt:ND3 function

    • Assessment of compensatory mechanisms in response to mt:ND3 dysfunction

  • Response to environmental stressors

    • Evaluation of mt:ND3 expression changes under different conditions

    • Identification of stress-responsive regulatory mechanisms

    • Cell type-specific stress responses

A typical scRNA-seq workflow for mt:ND3 studies might include:

  • Single-cell isolation from relevant tissues (e.g., testes, flight muscle)

  • Library preparation capturing both nuclear and mitochondrial transcripts

  • Sequencing with sufficient depth to detect mitochondrial transcripts

  • Bioinformatic analysis including dimensionality reduction (e.g., UMAP)

  • Cell clustering and identification using known markers

  • Analysis of mt:ND3 expression patterns across cell types

  • Integration with other omic data (proteomics, metabolomics)

scRNA-seq has successfully identified comprehensive cell populations in Drosophila testes, revealing distinct transcriptional profiles for different cell types . Similar approaches could be applied to study mt:ND3 expression in various tissues and under different conditions.

What are the implications of mt:ND3 structure on complex I assembly and stability?

The structure of mt:ND3 has significant implications for complex I assembly, stability, and function. Based on structural studies of respiratory complex I from Drosophila melanogaster, several important features can be identified:

Complex I is a large assembly of 43 subunits in Drosophila, with mt:ND3 occupying a critical position within the membrane domain . The structure of Drosophila complex I shows high structural homology to mammalian complex I, indicating evolutionary conservation of this important respiratory enzyme .

Key structural features of mt:ND3 that contribute to complex I include:

Recent structural studies have revealed that Drosophila complex I can exist in multiple conformational states, including active (Dm1), twisted (Dm2), and "cracked" (Dm3) states . The transitions between these states likely involve movements of mt:ND3 relative to other subunits.

Understanding the structural features of mt:ND3 and their contributions to complex I assembly and stability is essential for interpreting the functional consequences of mt:ND3 variants and for developing strategies to modulate complex I activity for research or therapeutic purposes.

What purification strategies yield the highest quality recombinant mt:ND3?

Purifying recombinant mt:ND3 to high quality requires careful consideration of this protein's membrane-bound nature and relatively small size (117 amino acids). Based on established protocols for similar proteins, an effective purification strategy includes:

  • Expression system selection

    • For highest yield: E. coli or yeast systems

    • For optimal folding and activity: Insect or mammalian cell systems

  • Solubilization considerations

    • Gentle detergents (e.g., DDM, LMNG) to extract from membranes without denaturation

    • Detergent concentration optimization to maintain native-like lipid environment

  • Chromatography sequence

    • Initial capture: Affinity chromatography using engineered tags (His, FLAG, etc.)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size-exclusion chromatography to separate monomeric protein from aggregates

  • Quality assessment

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to assess secondary structure content

    • Activity assays if appropriate functional tests exist

For recombinant mt:ND3 specifically, storage in a Tris-based buffer with 50% glycerol has been recommended for maintaining stability . The protein should be stored at -20°C for routine use, or at -80°C for extended storage .

It's worth noting that purification of individual complex I subunits is challenging due to their hydrophobic nature and normal existence as part of a large complex. Some researchers opt instead to purify intact complex I and study mt:ND3 within its native protein environment .

How can researchers effectively study the functional effects of mt:ND3 variants?

Studying the functional effects of mt:ND3 variants requires a multi-faceted approach that combines genetic, biochemical, and physiological methods:

  • Genetic approaches

    • Creation of mitonuclear introgression lines carrying different mt:ND3 variants

    • Site-directed mutagenesis to introduce specific mutations

    • CRISPR-based approaches for mitochondrial gene editing (though technically challenging)

  • Biochemical assays

    • Complex I activity measurements (NADH:ubiquinone oxidoreductase activity)

    • Oxygen consumption rate determination

    • ATP production quantification

    • ROS (reactive oxygen species) measurement

    • Mitochondrial membrane potential assessment

  • Structural studies

    • Comparison of complex I structures with different mt:ND3 variants

    • Analysis of conformational states and transitions

    • Molecular dynamics simulations to predict effects of mutations

  • Physiological parameters

    • Development time and viability assessment

    • Adult longevity measurement

    • Offspring sex ratio determination

    • Stress resistance evaluation (e.g., desiccation tolerance)

    • Metabolic rate measurement

  • Comparative analysis

    • Between sexes to identify sex-specific effects

    • Across different nuclear backgrounds to assess mitonuclear interactions

    • Under different environmental conditions to evaluate context-dependent effects

When designing these studies, it's important to consider that the effects of mt:ND3 variants may depend on the nuclear genetic background, sex of the organism, and environmental conditions . A comprehensive assessment should therefore include multiple genetic backgrounds and testing conditions.

What emerging technologies could advance mt:ND3 research?

Several emerging technologies hold promise for advancing our understanding of mt:ND3 structure, function, and regulation:

  • Cryo-electron tomography

    • Visualization of complex I in its native membrane environment

    • Structural analysis of mt:ND3 in different conformational states

    • Insights into interactions with other respiratory complexes

  • Mitochondrial gene editing

    • CRISPR-based approaches adapted for mitochondrial DNA

    • Base editing technologies for precise modification of mt:ND3

    • Creation of isogenic lines with specific mt:ND3 variants

  • Single-molecule techniques

    • FRET (Förster resonance energy transfer) to study conformational dynamics

    • Optical tweezers to investigate mechanical properties

    • Single-molecule tracking to analyze movement within membranes

  • Multi-omics integration

    • Combination of transcriptomics, proteomics, and metabolomics data

    • Systems biology approaches to model mt:ND3 function in cellular networks

    • Machine learning for prediction of variant effects

  • Advanced imaging techniques

    • Super-resolution microscopy of mitochondrial structures

    • Label-free imaging of mitochondrial function

    • In vivo imaging of mitochondrial dynamics

These technologies, especially when used in combination, could provide unprecedented insights into how mt:ND3 variants affect complex I assembly, conformational dynamics, and ultimately mitochondrial function and organismal fitness.

How might mt:ND3 research contribute to understanding human mitochondrial disorders?

Research on Drosophila mt:ND3 has significant implications for understanding human mitochondrial disorders, particularly those involving complex I dysfunction:

  • Evolutionary conservation

    • Drosophila complex I shows high structural homology to mammalian complex I

    • Many pathogenic mutations in human MT-ND3 affect residues conserved in Drosophila

    • Insights from Drosophila can often be translated to human mitochondrial biology

  • Disease modeling

    • Drosophila mt:ND3 variants can model human MT-ND3 mutations

    • Effects on complex I assembly, stability, and function can be studied in vivo

    • Phenotypic consequences can be assessed at multiple levels of biological organization

  • Mitonuclear interactions

    • Sex-specific mitonuclear effects observed in Drosophila may provide insights into variable penetrance of human mitochondrial disorders

    • Understanding nuclear genetic modifiers in Drosophila could identify therapeutic targets

    • Insights into mitonuclear compatibility could inform mitochondrial replacement therapies

  • Therapeutic development

    • Drosophila models allow high-throughput screening of potential therapeutics

    • Understanding conformational states of complex I could guide development of state-specific modulators

    • Insights into compensatory mechanisms could reveal new therapeutic approaches

  • Aging and degenerative diseases

    • Mitochondrial dysfunction contributes to aging and neurodegenerative diseases

    • Effects of mt:ND3 variants on longevity in Drosophila may provide insights into human aging

    • Sex-specific effects may help explain sex differences in human disease prevalence

The well-developed genetic toolkit available for Drosophila, combined with their complex physiology and the evolutionary conservation of complex I, makes this model organism particularly valuable for translational research related to human mitochondrial disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.