Recombinant Drosophila virilis Opsin Rh4 (Rh4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate with us beforehand. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rh4; Opsin Rh4; Inner R7 photoreceptor cells opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Drosophila virilis (Fruit fly)
Target Names
Rh4
Target Protein Sequence
MDIAGSLCNASEGPVLRPEARVSGNGDLQFLGWNVPPDQIQHIPEHWLTQLEPPASMHYM LGVFYIFLFCASTVGNGMVIWIFSTSKALRTPSNMFVLNLAVFDFIMCLKAPIFIYNSFH RGFALGNTGCQIFAAIGSYSGIGAGMTNAAIGYDRLNVITKPMNRNMTFTKAIIMNVIIW LYCTPWVVLPLTQFWDRFVPEGYLTSCTFDYLTDNFDTRLFVGTIFFFSFVCPTLMIIYY YSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKDTAEIRIAKAAITICFLFFVSWTPY GVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLAIDE KAPESSSAASTTTTQEQQQTTAA
Uniprot No.

Target Background

Function
Visual pigments are light-absorbing molecules crucial for vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Drosophila virilis Rh4 differ structurally from Drosophila melanogaster Rh4?

While the protein-coding sequences of Rh4 are highly conserved between D. melanogaster and D. virilis, there are significant differences in genomic organization. In D. melanogaster, the seven in absentia (sina) gene is located within an intron of the Rh4 opsin gene, whereas in D. virilis, these genes are widely separated on the chromosome . Additionally, the D. virilis Rh4 gene lacks the intron present in D. melanogaster Rh4, suggesting that Rh4 was translocated to another chromosomal location by a retrotransposition event during evolution . This structural difference represents an important consideration when designing experiments involving genetic manipulation of these organisms.

What is the phylogenetic relationship between Rh4 and other Drosophila opsins?

Phylogenetic analysis reveals that Drosophila opsins form two distinct clades with strong branching support values. Rh4 belongs to Clade-I along with Rh3 and Rh5, with Rh4 and Rh3 being more closely related to each other than to Rh5 . Specifically, Rh4 shares 72% amino acid identity with Rh3 but only about 35% homology with other Drosophila opsins (ninaE and Rh2) . The evolutionary proximity between Rh3 and Rh4 reflects their functional similarity as UV-sensitive opsins, while their divergence likely enabled the development of complementary expression patterns in different subsets of R7 photoreceptor cells.

What cellular specificity does Rh4 exhibit in Drosophila compound eyes?

Rh4 is expressed specifically in a subset of ultraviolet-sensitive R7 photoreceptor cells in the Drosophila compound eye . Importantly, Rh3 and Rh4 display complementary expression patterns, meaning they are expressed in non-overlapping subsets of R7 cells . This mutually exclusive expression creates a mosaic pattern of photoreceptor subtypes across the retina, contributing to the insect's UV vision capabilities. This pattern of expression appears to be conserved between D. melanogaster and D. virilis, despite their divergent genomic organizations, suggesting strong evolutionary pressure to maintain this functional arrangement.

How is the expression of Rh4 regulated at the transcriptional level?

Transcriptional regulation of Rh4 involves relatively small promoter regions (<300 bp) that contain all necessary DNA sequences to generate its specific expression pattern . Detailed characterization through promoter deletion series and interspecific sequence comparisons has revealed that Drosophila rhodopsin genes, including Rh4, share a bipartite promoter structure . The proximal region constitutes a functionally equivalent promoter "core," while the distal region determines cell-type specificity . This compact yet sophisticated regulatory architecture explains how the precise cellular expression pattern of Rh4 is achieved despite the gene's relatively small regulatory region.

What promoter regions are essential when designing recombinant Rh4 expression constructs?

When designing recombinant constructs for Rh4 expression, researchers should focus on the small regulatory regions (<300 bp) that have been demonstrated to contain all necessary cis-acting elements to reproduce the wild-type expression pattern . For D. virilis Rh4, promoter fragments of 300 and 190 bp can confer a completely R7-specific expression pattern on reporter constructs at levels comparable to those of D. melanogaster Rh4 constructs . This conservation of function across species indicates that these small promoter regions interact effectively with the transcriptional machinery despite species differences, making them ideal targets for recombinant expression studies.

How can interspecies promoter analysis be used to identify functional cis-acting elements in Rh4?

Interspecies promoter analysis has proven to be a powerful approach for identifying functional cis-acting elements in Rh4. By comparing the DNA sequences of rhodopsin promoters between distantly related species such as D. melanogaster and D. virilis, researchers can identify conserved sequences that likely represent important regulatory elements . These evolutionarily conserved sequences are clustered within the 150 bp immediately upstream of the transcriptional start site of each promoter . Functional testing of these elements can be accomplished by creating reporter gene constructs with D. virilis promoter fragments and introducing them into D. melanogaster, where they will generate R7-specific patterns of gene expression if the conserved elements are functional .

To what extent are the functional properties of Rh4 conserved between Drosophila species?

Despite approximately 60 million years of evolutionary separation between D. melanogaster and D. virilis, the protein-coding sequences of the Rh4 gene are highly conserved between these species . This conservation extends to the functional level, as small D. virilis Rh4 promoters interact effectively with the D. melanogaster transcriptional machinery to generate R7-specific patterns of gene expression . This conservation suggests that the fundamental properties and functions of Rh4 as a UV-sensitive opsin have remained largely unchanged throughout Drosophila evolution, emphasizing its essential role in insect vision.

What structural gene arrangements distinguish D. virilis Rh4 from D. melanogaster Rh4, and what are the implications for experimental design?

The most striking difference in gene arrangement is that while in D. melanogaster the sina gene is located within an intron of the Rh4 opsin gene, in D. virilis, these genes are widely separated . Additionally, D. virilis Rh4 lacks the intron present in the D. melanogaster gene . These differences suggest that a retrotransposition event occurred during evolution, resulting in the translocation of the Rh4 gene to another chromosomal location in D. virilis . When designing experiments involving genetic manipulation or recombinant expression, researchers must account for these structural differences, particularly when targeting intronic regions or when the genomic context might affect gene expression.

How can oligonucleotide-directed mutagenesis guided by interspecific sequence comparisons be applied to study Rh4 regulation?

Oligonucleotide-directed mutagenesis guided by interspecific sequence comparisons represents a sophisticated approach to studying Rh4 regulation . By identifying conserved sequences between D. melanogaster and D. virilis Rh4 promoters, researchers can target specific nucleotide changes to these regions to assess their functional importance. This targeted approach is more efficient than systematic mutagenesis of all nucleotides in a promoter region . The finding that D. virilis Rh4 promoters are active in D. melanogaster in an R7-specific manner supports the assertion that evolutionarily conserved sequences are strong candidates for cis-acting regulatory elements .

What techniques can be used to study the functional consequences of the different chromosomal arrangements of Rh4 and sina genes between Drosophila species?

To study the functional consequences of different chromosomal arrangements, researchers can employ several advanced techniques:

  • Chromosome Conformation Capture (3C) and derivatives: These methods can reveal long-range interactions between Rh4 and sina in D. melanogaster versus D. virilis to understand how spatial organization affects gene regulation.

  • CRISPR-Cas9 genome editing: This can be used to recreate the D. virilis arrangement in D. melanogaster (separating Rh4 and sina) or vice versa, to directly test the functional impact of these arrangements.

  • Hybrid promoter constructs: Creating chimeric constructs that combine the core and cell-type specificity regions of different rhodopsin promoters can help understand the modularity of these regulatory elements .

The different structural arrangements between species provide a natural experiment to understand the evolution of gene position and its impact on function, particularly the consequences of retrotransposition events in genome evolution .

What reporter systems are most effective for studying Rh4 expression patterns?

Based on research findings, both lacZ and CAT reporter systems have been effectively used to study Rh4 expression patterns . Rh4-lacZ fusions have proven particularly valuable for visualizing the specific expression pattern in R7 photoreceptor cells . When designing such reporter constructs, small promoter fragments (190-300 bp) of Rh4 have been shown to contain all necessary cis-acting information to reproduce the wild-type expression pattern . For cross-species studies, D. virilis Rh4 promoter fragments of similar size confer R7-specific expression patterns on reporter constructs at levels comparable to those of D. melanogaster Rh4 constructs .

How should researchers approach the expression of recombinant Rh4 for functional studies?

When expressing recombinant Rh4 for functional studies, researchers should consider the following methodological approaches:

  • Promoter selection: Use the minimal functional promoter regions (<300 bp) that have been demonstrated to contain all necessary regulatory elements .

  • Expression system compatibility: Consider that D. virilis Rh4 promoters function effectively in D. melanogaster, indicating cross-species compatibility of the transcriptional machinery .

  • Cell-type specificity: Design constructs that maintain the R7-specific expression pattern to ensure physiologically relevant results .

  • Evolutionary conservation: Target the 28 amino acids that are conserved among all invertebrate and vertebrate opsin genes, as these residues likely play important roles in rhodopsin function .

By carefully considering these factors, researchers can design expression systems that accurately recapitulate the natural expression and function of Rh4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.