Recombinant Drosophila virilis Protein brown (bw)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Drosophila virilis Protein brown (bw) is derived from the bw gene (Q24739), which encodes a transmembrane transporter involved in pteridine pigment regulation. In Drosophila, the wild-type bw gene facilitates the uptake of guanine and xanthine, precursors for red eye pigments . The recombinant form retains this function and is used to rescue pigmentation defects in mutant strains .

Transporter Activity

  • Substrate Specificity: Mediates guanine and xanthine uptake, analogous to the D. melanogaster bw protein .

  • Conservation: The D. virilis bw gene rescues eye color defects in D. melanogaster bw mutants, confirming functional conservation .

Genetic Interactions

  • Trans-Inactivation: Recombinant D. virilis bw undergoes trans-inactivation when paired with heterochromatic alleles in D. melanogaster, demonstrating conserved regulatory sequences .

  • Position Effect Variegation (PEV): Silencing of recombinant bw in heterochromatic contexts depends on somatic pairing and chromosomal proximity to heterochromatin .

Research Applications

Recombinant bw protein is utilized in:

  1. Transport Mechanism Studies: Investigating substrate specificity and competitive inhibition using radiolabeled guanine .

  2. Epigenetic Regulation: Analyzing PEV and trans-inactivation dynamics via fluorescence in situ hybridization (FISH) .

  3. Evolutionary Biology: Comparing functional conservation between Drosophila species .

Table 1: Pteridine Levels in bw Mutants (HPLC Analysis)

Pteridine TypeWild-Type (nmol/eye)bw Mutant (nmol/eye)
Neodrosopterin1.2 ± 0.30.1 ± 0.02
Drosopterin0.8 ± 0.20.05 ± 0.01
Isoxanthopterin0.4 ± 0.11.5 ± 0.4

Table 2: Key Alleles and Phenotypic Effects

Allele TypePhenotypeChromosomal Rearrangement
bw<sup>D</sup>Variegated eye colorHeterochromatin insertion
bw<sup>R</sup>Homozygous lethal, brown eyesX-ray-induced breaks

Technical Notes

  • Storage: Recombinant bw protein is stable at -20°C for short-term storage; long-term conservation requires -80°C .

  • Expression Systems: Typically produced in E. coli or insect cell cultures for functional assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
bw; Protein brown
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-668
Protein Length
full length protein
Species
Drosophila virilis (Fruit fly)
Target Names
bw
Target Protein Sequence
MPMDEGDAQGSLLLEWKQLNYYVPAQEQSNYSFWNECRKQRELGILHDVSGHLKTGDLIA ILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERDQMTRISSFLREFEINVKTFTAY DDLYFMSHFKMHRRTTKSEKRQAVSDLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELIT DPIFLFCDEPTTGLDSFSAYTVIKTLRHLCTRRRIAKHSLTQVYGEDSFATPSDNGSSGS NSIEMEIVDNSHESLLQAMKELPTLGVLNNSPNGTQKKAAICSIHQPTSDIFELFTHIIL MDGGRIVYQGRTEQAAKFFTEGFMQPKNCNPADFYLKTLADGQGSKNAGELLRAKYEHET DGLYSGSWLLARNYSGDYMKHVQNFKKIRWIYQVYLLVIRFMTEDLANIRSGLIGFGFFM TTAVTLSLMYSGVGGLTQRTVQDVGGSIFMLSNEMIFTFSYGVTYIFPAALPIIRREVAE GTYSLSAYYVALVLSFVPVAFFKGYMFLSVIYASIYYTRGFLLYITMGFLMSLSAIAAVG YGVFLSSLFETDKMASECAAPFDLIFLIFGGTYMNVDSVPLLKYFSLFFYSNEALMYNFW IDIDNIACXVNDEHPCCQTGLEVLQQASFRTADYTFWLDCASLLVVALVFHIVSFTLIRR YINRSGYY
Uniprot No.

Target Background

Function
This protein is part of a membrane-spanning permease system essential for transporting pigment precursors into pigment cells, which are responsible for eye color. Brown and white dimerize for the transport of guanine.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in eyes.

Q&A

What is the brown (bw) gene in Drosophila virilis and how does it compare to other Drosophila species?

The brown (bw) gene in D. virilis encodes a protein that shows remarkable conservation with its D. melanogaster homologue, exhibiting 86% identity at the amino acid level. This gene is not only structurally conserved but also functionally homologous, as demonstrated by cross-species rescue experiments. The D. virilis brown gene can successfully rescue D. melanogaster null brown mutations, indicating that the protein functions similarly in both species despite approximately 60 million years of evolutionary divergence. This conservation extends to regulatory elements as well, with significant sequence similarity observed in regions upstream of the open reading frame .

The conservation of the brown gene across Drosophila species suggests it serves an essential function that has been maintained through evolutionary time. Functional studies indicate that the brown protein is involved in pigment transport, particularly for pteridine pigments that contribute to eye coloration. Mutations in this gene typically result in brown-colored eyes instead of the wild-type red, reflecting its role in pigmentation pathways .

What molecular mechanisms govern brown gene expression regulation in D. virilis?

The brown gene in D. virilis is subject to complex regulatory mechanisms, particularly those involving heterochromatin-mediated transcriptional regulation. Studies comparing D. virilis and D. melanogaster have revealed that both species exhibit a phenomenon known as trans-inactivation, in which heterochromatin can influence gene expression in trans (affecting the homologous chromosome). This process is associated with position effect variegation (PEV), where gene expression becomes unstable due to proximity to heterochromatin .

The conservation of trans-inactivation between these species suggests that the mechanism is mediated by shared regulatory factors. Current evidence supports a model in which heterochromatin-sensitive transcription factors play a crucial role in this process. These factors interact with conserved regulatory sequences upstream of the brown gene, as indicated by the extended region of sequence similarity found upstream of the open reading frame in both species. When heterochromatin forms near one copy of the brown gene (as in the bw(D) mutation), it can lead to silencing of both the local gene copy and its homologue on the other chromosome .

How does genomic context affect brown gene function in D. virilis?

The genomic context significantly impacts brown gene function in D. virilis, particularly with respect to its interactions with heterochromatin. D. virilis possesses pericentromeric satellites that constitute almost half of its genome, creating a unique chromatin environment that can influence gene expression . The brown gene's susceptibility to position effects makes it particularly sensitive to its genomic neighborhood.

Studies of the bw(D) mutation in D. melanogaster (which has a D. virilis homologue) have shown that insertion of heterochromatin into the region of the brown gene leads to variegated expression. The severity of this variegation can be modified by chromosomal rearrangements that alter the gene's position relative to heterochromatic regions. Translocations that bring the brown gene closer to the chromocenter enhance variegation, while those that move it away tend to suppress it .

The nuclear position of the brown gene also influences its expression. The bw(D) heterochromatic insertion tends to associate with the chromocenter, and rearrangements that strengthen this association enhance variegation. This suggests that the three-dimensional organization of the nucleus plays a role in brown gene regulation, with heterochromatin formation at the brown locus dependent on its location within the nuclear architecture .

How does hybrid dysgenesis in D. virilis affect brown gene expression and recombination?

Hybrid dysgenesis in D. virilis represents a complex syndrome triggered when males with multiple active transposable element (TE) families fertilize females lacking active copies of these elements. This genetic incompatibility leads to gonadal atrophy driven by germline stem cell death and increased transposition of paternally inherited TE families. While the direct effects on brown gene expression have not been fully characterized, the dysgenesis syndrome provides important insights into how recombination and genome stability might influence genes like brown in D. virilis .

Research has demonstrated that hybrid dysgenesis in D. virilis can result in clusters of mitotic recombination events. These events are associated with excision of specific transposable elements, particularly Paris and Polyphemus DNA transposons, providing direct evidence that transposition-induced DNA damage underlies the dysgenesis syndrome. Such DNA damage and subsequent repair could potentially affect brown gene expression if recombination occurs in or near the brown locus .

Interestingly, while mitotic recombination increases during dysgenesis, meiotic recombination appears robust to TE activation, with no significant differences observed between genetically identical dysgenic and non-dysgenic female progeny. This suggests differential sensitivity of mitotic versus meiotic recombination mechanisms to TE-induced genome instability, which could have implications for studying recombinant brown protein expression .

What challenges are associated with recombinant expression of D. virilis brown protein?

Recombinant expression of D. virilis brown protein presents several challenges stemming from its biological properties and regulation. The brown protein is a transmembrane ATP-binding cassette (ABC) transporter involved in pigment precursor transport, making it challenging to express in soluble, functional form. Its complex membrane topology requires appropriate cellular machinery for correct folding and membrane insertion, limiting the choice of expression systems.

The protein's susceptibility to heterochromatin-mediated regulation adds another layer of complexity. As demonstrated by trans-inactivation studies, the brown gene is sensitive to chromatin states, which might complicate expression in heterologous systems where chromatin regulation differs from Drosophila . Expression strategies must consider these regulatory aspects to achieve functional protein production.

Additionally, the D. virilis genome contains abundant transposable elements and satellite sequences that make up nearly half its genome, potentially affecting the stability of expression constructs containing brown sequences . Careful design of expression vectors and selection of appropriate host systems are critical for successful recombinant expression.

How can comparative studies between D. virilis and D. melanogaster brown proteins inform evolutionary conservation of gene regulation?

Comparative studies between D. virilis and D. melanogaster brown proteins provide valuable insights into the evolutionary conservation of gene regulation mechanisms, particularly those involving heterochromatin-mediated control. The high degree of sequence identity (86%) between these proteins, coupled with functional interchangeability demonstrated by cross-species rescue experiments, creates an excellent platform for investigating conserved regulatory mechanisms .

The conservation of trans-inactivation between these species is particularly informative. When the D. virilis brown gene is introduced into D. melanogaster, it becomes subject to dominant position effect variegation similar to the native gene. This indicates that the sequences required for heterochromatin sensitivity have been conserved for approximately 60 million years of independent evolution, suggesting strong selective pressure to maintain this regulatory mechanism .

These comparative studies support a model in which trans-inactivation is mediated by heterochromatin-sensitive transcription factors that recognize conserved sequences in both species. The extended region of sequence similarity upstream of the coding region likely contains these conserved regulatory elements . This model provides a framework for understanding how heterochromatin can influence gene expression across evolutionary time, potentially informing broader principles of genome organization and regulation.

What techniques are most effective for studying brown gene regulation in D. virilis?

Several complementary techniques have proven effective for studying brown gene regulation in D. virilis, each addressing different aspects of its complex regulation. Genetic approaches using classical crossing schemes remain valuable for analyzing inheritance patterns and identifying modifiers of brown expression. These can be combined with cytological analysis to correlate genetic effects with chromosomal structure and organization .

For analyzing heterochromatin-mediated regulation, chromosome conformation capture techniques (3C, 4C, Hi-C) are powerful tools for examining three-dimensional interactions between the brown locus and heterochromatic regions. These approaches can reveal how nuclear positioning influences brown gene expression and helps explain phenomena like trans-inactivation .

Molecular techniques such as ChIP-seq (Chromatin Immunoprecipitation followed by sequencing) can identify proteins associated with the brown locus under different conditions, revealing factors involved in its regulation. RNA-seq provides comprehensive information about expression levels and splicing patterns, while ATAC-seq can reveal changes in chromatin accessibility at the brown locus in response to different genetic backgrounds or developmental stages .

For functional analysis of the brown protein itself, transgenic approaches where the D. virilis brown gene is introduced into D. melanogaster brown mutants can assess functional conservation and identify regulatory sequences. This cross-species complementation approach has already demonstrated the functional homology between D. virilis and D. melanogaster brown genes .

What expression systems are optimal for recombinant D. virilis brown protein production?

The optimal expression system for recombinant D. virilis brown protein depends on the experimental objectives and the protein's intended use. For structural studies requiring large quantities of purified protein, insect cell expression systems such as Sf9 or High Five cells (derived from Spodoptera frugiperda and Trichoplusia ni, respectively) offer advantages. These systems provide eukaryotic post-translational modifications and membrane structures similar to those in Drosophila, facilitating proper folding of the transmembrane brown protein.

For functional studies, Drosophila S2 cells represent an excellent choice as they provide the most native cellular environment. S2 cells contain the appropriate chaperones and membrane composition for correct folding and localization of the brown protein. Additionally, they possess the regulatory machinery that might be important for the protein's function, particularly if it is subject to post-translational regulation.

If the goal is to study the brown protein in vivo, transgenic approaches in D. melanogaster brown mutants offer a powerful system. The demonstrated ability of the D. virilis brown gene to rescue D. melanogaster brown mutations confirms that this heterologous expression approach can yield functional protein . This system allows for assessment of the protein's activity in its natural cellular context and permits investigation of regulatory aspects that might be missed in cell culture systems.

How can CRISPR/Cas9 technology be applied to study the brown gene in D. virilis?

CRISPR/Cas9 technology offers powerful approaches for studying the brown gene in D. virilis, enabling precise genetic manipulations that were previously challenging in non-model Drosophila species. This technology can be applied in several ways to advance our understanding of brown gene function and regulation.

For functional studies, CRISPR/Cas9 can generate precise mutations in the brown gene, creating allelic series that affect specific domains or regulatory elements. This approach can help map structure-function relationships within the protein and identify critical residues for pigment transport activity. By comparing the phenotypes of these mutations with those in D. melanogaster, researchers can assess the conservation of functional domains across species.

To study regulatory mechanisms, CRISPR/Cas9 can be used to modify the upstream regulatory regions identified through sequence conservation between D. virilis and D. melanogaster. This approach can pinpoint specific elements responsible for heterochromatin sensitivity and trans-inactivation. Additionally, CRISPR-mediated epigenetic modifiers (using catalytically inactive Cas9 fused to chromatin-modifying enzymes) can alter the chromatin state at the brown locus to directly test how heterochromatin influences gene expression.

For protein localization and interaction studies, CRISPR/Cas9 can introduce fluorescent or affinity tags at the endogenous brown locus, allowing visualization of the protein in its native context or facilitating purification of protein complexes. This approach preserves the natural regulatory context of the gene, providing more physiologically relevant information than overexpression systems.

How does genomic organization around the brown locus differ between D. virilis and related species?

The genomic organization around the brown locus shows interesting differences between D. virilis and its sister species, reflecting broader genomic changes during evolution. D. virilis possesses a significantly larger genome (389 Mb) compared to its close relatives D. novamexicana and D. americana (~250 Mb). This difference is largely attributed to the abundance of pericentromeric satellites and transposable elements in D. virilis, which make up almost half of its genome .

This expanded satellite content likely affects the three-dimensional organization of chromosomes within the nucleus, potentially influencing the regulation of genes like brown through altered spatial relationships with heterochromatic regions. The brown locus's interaction with heterochromatin has been shown to be important for its regulation, as demonstrated by studies of position effect variegation in D. melanogaster .

Comparative analysis of recombination rates also reveals important differences between Drosophila species. D. virilis exhibits significantly higher recombination rates than D. melanogaster, which could affect the evolutionary dynamics of the brown locus and surrounding regions . These differences in recombination landscape may contribute to the distinct patterns of sequence conservation observed around functional genes versus repetitive elements.

What is the comparative table of brown gene features across Drosophila species?

FeatureD. virilisD. melanogasterD. novamexicana/D. americana
Protein sequence identityReference86% identity with D. virilisNot fully characterized
Genome size389 Mb175 Mb~250 Mb
Satellite DNA content~50% of genome~20% of genomeLower than D. virilis
Functional complementationCan rescue D. melanogaster brown mutations-Not tested
Trans-inactivationPresentPresentNot characterized
Recombination rateHigher than D. melanogasterLower than D. virilisNot fully characterized
Susceptibility to position effectsObservedWell-documentedNot characterized
Regulatory sequence conservationReferenceExtended region of similarity upstream of coding sequenceNot fully characterized

This table highlights the conserved and divergent features of the brown gene and its genomic context across Drosophila species, emphasizing the unique characteristics of D. virilis that make it valuable for comparative studies .

What are the key unresolved questions about recombinant D. virilis brown protein?

Despite significant advances in understanding the brown gene in D. virilis, several key questions remain unresolved. The precise molecular mechanism of trans-inactivation is not fully understood, though evidence suggests involvement of heterochromatin-sensitive transcription factors . The identity of these factors and how they recognize and respond to heterochromatin states represents an important area for future investigation.

The three-dimensional structure of the brown protein has not been determined for any Drosophila species, limiting our understanding of its transport mechanism and substrate specificity. Structure-function studies using recombinant protein could reveal how the protein's architecture enables its role in pigment transport and how this function has been conserved across species despite sequence divergence.

The potential role of the brown locus in hybrid dysgenesis remains unexplored. Given that hybrid dysgenesis in D. virilis involves widespread genomic instability and altered recombination patterns , understanding how this affects expression and function of essential genes like brown could provide insights into mechanisms of speciation and genomic compatibility.

How might new technologies advance research on D. virilis brown protein?

Emerging technologies offer exciting opportunities to address unresolved questions about the D. virilis brown protein. Long-read sequencing technologies (Oxford Nanopore, PacBio) can provide more accurate assemblies of the repetitive-rich D. virilis genome, enabling better characterization of the brown locus and its genomic context, including nearby regulatory elements and transposable elements.

Advanced single-cell technologies combine transcriptomics and epigenomics to reveal cell-type-specific regulation of the brown gene. This approach could help understand how brown expression is developmentally regulated in different tissues and how position effects manifest at the single-cell level.

Cryo-electron microscopy techniques are advancing rapidly for membrane proteins, potentially enabling structure determination of the brown protein. This would provide unprecedented insights into its transport mechanism and could facilitate structure-based design of mutations for functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.