Recombinant Drosophila virilis Serine protease HTRA2, mitochondrial (HtrA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila virilis Serine Protease HTRA2, Mitochondrial (HtrA2)

Recombinant Drosophila virilis Serine Protease HTRA2, mitochondrial (HtrA2), is a recombinant protein derived from the fruit fly species Drosophila virilis. This protein belongs to the HtrA family of serine proteases, which are known for their roles in protein quality control, stress response, and apoptosis regulation. The HtrA2 protein in Drosophila species, including Drosophila virilis, shares functional similarities with its mammalian counterparts, such as involvement in maintaining mitochondrial integrity and responding to cellular stress.

Structure and Function

The HtrA2 protein typically consists of a mitochondrial targeting sequence, a protease domain, and a PDZ domain. The PDZ domain is crucial for protein-protein interactions, while the protease domain provides the enzymatic activity necessary for protein degradation. In Drosophila, HtrA2 has been shown to cleave DIAP1, an inhibitor of apoptosis protein, thereby regulating apoptosis under certain conditions .

FeatureDescription
SpeciesDrosophila virilis
Protein TypeSerine protease
LocationMitochondrial
FunctionProtein quality control, stress response, apoptosis regulation
DomainsMitochondrial targeting sequence, protease domain, PDZ domain

Research Findings

Research on Drosophila HtrA2 has highlighted its role in maintaining mitochondrial function and its interaction with other genes involved in mitochondrial integrity, such as PINK1 and parkin. Studies have shown that while HtrA2 is not essential for apoptosis, it plays a role in stress resistance and mitochondrial health . Mutants of HtrA2 in Drosophila exhibit phenotypes similar to those of parkin and PINK1 mutants, indicating a potential role in pathways related to Parkinson's disease .

PhenotypeDescription
Mitochondrial IntegrityMild defects in mitochondrial function
Stress ResistanceSensitivity to oxidative stress and mitochondrial toxins
ApoptosisDispensable for developmental or stress-induced apoptosis
FertilityMale infertility observed in mutants

Recombinant Protein Production

Recombinant HtrA2 proteins are often produced in Escherichia coli (E. coli) for research purposes. These proteins are typically His-tagged to facilitate purification and are available in lyophilized form. The recombinant protein from Drosophila virilis would be expected to have similar characteristics, with a high purity level (>90%) as determined by SDS-PAGE, and would require careful storage conditions to maintain stability .

Production DetailsDescription
Expression HostEscherichia coli
TagHis-tag
PurityGreater than 90%
StorageStore at -20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HtrA2; GJ24448; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
74-421
Protein Length
Full Length of Mature Protein
Species
Drosophila virilis (Fruit fly)
Target Names
Target Protein Sequence
ALASTMVAQREELTPTISARALSGRRREFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFVIEQNGLILTNAHVVINKPNTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVNNLSVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAARRRKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRTQNMPNTLSHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADGKKELDIVILRGVKQMRVTITPEDP
Uniprot No.

Target Background

Function

Recombinant Drosophila virilis Serine protease HTRA2, mitochondrial (HtrA2) is a serine protease exhibiting proteolytic activity against the nonspecific substrate β-casein. It promotes or induces cell death through two mechanisms: 1) direct binding and inhibition of BIRC proteins (Inhibitor of Apoptosis Proteins, IAPs), resulting in increased caspase activity; and 2) a BIRC-independent, caspase-independent mechanism reliant on serine protease activity. This protease can antagonize the anti-apoptotic activity of IAPs by directly inducing their degradation.

Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.