Recombinant Drosophila virilis Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila virilis Spastin (spas)

Recombinant Drosophila virilis Spastin (spas) is a purified protein produced in yeast for experimental applications. Spastin is an ATPase associated with diverse cellular activities (AAA) protein, conserved across species, and known for its microtubule-severing activity. The Drosophila virilis isoform shares functional homology with Drosophila melanogaster and human Spastin, which are implicated in neurodegenerative disorders like hereditary spastic paraplegia (HSP) .

Microtubule Regulation

  • Activity: Spastin severs microtubules via its AAA ATPase domain, modulating cytoskeletal dynamics .

  • Localization: Enriched in synaptic boutons and apical domains of photoreceptors, influencing neuronal morphology and membrane trafficking .

Neuromuscular Junction (NMJ) Phenotypes

  • Loss-of-function: Null mutants exhibit synaptic overgrowth, impaired neurotransmission, and destabilized microtubule networks .

  • Overexpression: Reduces stable microtubules, causing synaptic undergrowth and weakened neurotransmission .

Lipid Droplet Association

  • Spastin-M1 isoform targets lipid droplets (LDs), with hydrophobic motifs (amino acids 57–86) essential for LD localization. Overexpression alters LD size and triacylglycerol levels in Drosophila tissues .

Research Applications of Recombinant Drosophila virilis Spastin

  • Mechanistic Studies: Investigate microtubule dynamics, synaptic function, and lipid metabolism in Drosophila virilis.

  • Disease Modeling: Explore HSP-linked pathways using conserved Spastin functions .

  • Structural Analysis: Characterize ATPase domain interactions or severing mechanisms.

Limitations and Future Directions

  • Data Gap: No peer-reviewed studies specifically addressing Drosophila virilis Spastin are available in the provided sources. Current insights rely on homologs.

  • Opportunities: Recombinant D. virilis Spastin could enable species-specific comparisons of microtubule regulation or HSP-related pathology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery time.
Note: Our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
spas; GJ24660; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Drosophila virilis (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSTKSPVKISGGGGGGGGSSSSTNRSRSCSEALIDDGKSSSKLSSN RQRTTTTITTTTTTPGSSPDDDTTDADLTPTSGNVPRGGQSVHKQNLYVVSFPIIFLFNV LRSLIYQLFCIFRYLYGASTKVIYRSPHRRDCNIEIVVQNSKEQQAIICPLEGSGVNIEQ AQILPQRQRALQTLEMAASRGGTGAGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEE NEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHEKMQTNLSMARDRLHFLA LREEDLQMQRLSLKEQPKKQLPHKFKQPMLVGQTTTSSGSSSSSRASAEPPKITLRSSGY GPKTGGATTSKAVPAASGRKLTIGNKRPGNLAVANKSQTLPRNLGSKTTSTSVGAALQRQ PGKTAATPPAVRRQFSSGRNTPPQRSRTPINNNAASGSGSGASTPLISVKGVEQKLVQLI LDEIVEGGAKVEWSDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGK TLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLS ERSSNEHEASRRLKTEFLVEFDGLPGNPEGDRIVVLAATNRPQELDEAALRRFTKRVYVS LPGVQTRELLLSRLLQKQGSPLDTEALARLAKITDGYSGSDLTALAKDAALEPIRELNVE QVKCLDISAMRPITEKDFHNSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is Spastin and what is its primary function in Drosophila?

Spastin is a microtubule-severing protein that plays critical roles in microtubule dynamics and cellular morphogenesis in Drosophila. The protein has been extensively studied in Drosophila melanogaster, where mutations in the spastin gene cause neurodegeneration phenotypes similar to those observed in humans with hereditary spastic paraplegia (HSP). Spastin's primary function involves modulating microtubule cytoskeleton through its ATPase activity, which enables the severing of microtubules .

In Drosophila photoreceptors, Spastin localizes to the apical membrane domain and stable microtubules, where it plays an essential role in apical domain biogenesis during rhabdomere elongation. This function is critical for proper photoreceptor morphogenesis during development . Loss of Spastin function results in dramatic reduction of the apical membrane domain, particularly at the proximal section of developing pupal eyes, indicating its importance in maintaining apical domain integrity during cellular elongation .

How is recombinant Drosophila Spastin typically produced for research applications?

Recombinant Drosophila Spastin is typically produced through bacterial expression systems, most commonly using E. coli. The full-length protein (as exemplified by D. melanogaster Spastin spanning amino acids 1-758) is expressed with an N-terminal His-tag to facilitate purification . The expression construct contains the complete coding sequence, allowing researchers to study the intact protein with all functional domains.

After expression, the protein undergoes purification procedures, typically involving affinity chromatography leveraging the His-tag. The purified protein is then lyophilized and can be reconstituted in appropriate buffers for experimental use. When reconstituting the protein, it is recommended to use deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability . The purity of commercially available recombinant Spastin typically exceeds 90% as determined by SDS-PAGE analysis.

What experimental models utilize Drosophila Spastin to study human diseases?

Drosophila Spastin serves as an excellent model for studying human autosomal dominant hereditary spastic paraplegia (AD-HSP), a neurodegenerative disease primarily caused by mutations in the human SPASTIN gene. The functional conservation between human and Drosophila Spastin has been demonstrated through rescue experiments, where expression of wild-type human Spastin can rescue behavioral and cellular defects in Drosophila spastin null mutants .

Researchers have developed several experimental paradigms using Drosophila:

  • Loss-of-function models: Complete spastin null flies exhibit striking behavioral similarities to human AD-HSP patients, including locomotor defects that worsen with age .

  • Dominant-negative models: Flies expressing the K388R catalytic domain mutation (equivalent to the human K388R mutation) in a null background show aberrant distal synapse morphology and microtubule distribution .

  • Trans-acting modifier models: Flies carrying the S44L and P45Q variants, which are largely silent when heterozygous but exacerbate mutant phenotypes when expressed in trans with R388, mirror the genetic interactions observed in human AD-HSP patients .

These models allow for detailed investigation of cellular and behavioral consequences of Spastin mutations directly relevant to the human disease condition.

What are the optimal storage conditions for maintaining recombinant Spastin activity?

To maintain optimal activity of recombinant Drosophila Spastin, storage conditions must be carefully controlled. The lyophilized protein powder should be stored at -20°C or -80°C upon receipt. Prior to opening, the vial should be briefly centrifuged to ensure all contents are at the bottom .

For reconstituted protein, aliquoting is essential to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality and activity. Working aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C with the addition of glycerol (typically at a final concentration of 50%) .

The buffer composition is also crucial for stability—Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides optimal conditions for maintaining protein integrity. Trehalose serves as a cryoprotectant that helps prevent denaturation during freeze-thaw cycles . When conducting experiments requiring repeated use of the protein, it is advisable to prepare multiple small aliquots rather than repeatedly freezing and thawing a single stock.

How does Spastin function in Drosophila photoreceptor development?

Spastin plays a critical role in apical domain control during photoreceptor morphogenesis in Drosophila. During pupal development, photoreceptor cells undergo elongation from the distal to proximal axis, with the apical membrane domain localizing to the center of photoreceptor clusters . This process is essential for the formation of rhabdomeres, the light-sensing structures in Drosophila eyes.

In spastin mutant photoreceptors, there is a dramatic reduction of the apical membrane domain, particularly at the proximal section of the developing pupal eye, while the distal section shows milder effects. This pattern of defects correlates with the direction of rhabdomere growth (distal to proximal), suggesting that Spastin is specifically required for maintaining the apical membrane domain during elongation .

The critical role of Spastin in this process is further evidenced by gain-of-function experiments. Overexpression of Spastin in photoreceptors causes dramatic expansion of the apical membrane domain (300±100% expansion) and concurrent mislocalization of adherens junctions (AJs). Despite these significant alterations in apical domain organization, cell polarity remains intact, as apical markers like Crumbs (Crb) still localize more apically compared to AJ markers like E-cadherin .

What molecular mechanisms underlie Spastin's role in microtubule dynamics in neural development?

Spastin regulates microtubule dynamics through its ATP-dependent microtubule-severing activity. In Drosophila, Spastin localizes to both stable microtubules and the apical membrane domain in developing photoreceptors . The microtubule-severing function appears to be critical for proper neuronal development, as evidenced by the neurodegeneration phenotypes observed in spastin mutants.

The molecular mechanism involves the AAA (ATPases Associated with diverse cellular Activities) domain of Spastin, which requires ATP binding and hydrolysis for function. The K388R mutation, which affects the ATP-binding site, causes complete loss of ATPase and microtubule-severing activity in vitro . This mutation is equivalent to the human K388R mutation that causes hereditary spastic paraplegia.

Interestingly, while Spastin's role in microtubule severing is well-established, research in Drosophila photoreceptors suggests that Spastin may have additional functions in apical domain regulation that could be partially independent of its effects on the main stable microtubule structures . This is supported by observations that stable microtubules were not dramatically altered by either spastin mutation or overexpression, despite significant changes in apical domain organization .

How do Spastin mutations affect phenotypes in Drosophila models, and what are their implications for human disease?

Spastin mutations in Drosophila produce phenotypes that closely mirror human hereditary spastic paraplegia, demonstrating remarkable functional conservation. Null mutations in Drosophila spastin result in progressive mobility defects, abnormal synaptic morphology, and altered microtubule distribution .

The K388R mutation (affecting the catalytic domain) demonstrates interesting phenotypic characteristics in Drosophila models:

  • When co-expressed with wild-type Spastin in a null background, it results in aberrant distal synapse morphology and microtubule distribution, similar to but less severe than complete nulls .

  • The mutation acts dominantly and can confer partial rescue of null phenotypes, suggesting that Spastin may have additional non-catalytic functions beyond its ATPase activity .

The S44L and P45Q variants, which correspond to human disease-modifying alleles, demonstrate genetic interactions that parallel those observed in human patients. These variants are largely silent when heterozygous but exacerbate mutant phenotypes when expressed in trans with the R388 mutation . This provides strong validation of the Drosophila model for studying the genetic complexity of human HSP.

The implications for human disease are significant, as the Drosophila models allow researchers to:

  • Test hypotheses directly relevant to human disease mechanisms

  • Evaluate potential therapeutic strategies

  • Study genetic modifiers that may influence disease severity

  • Investigate cellular and behavioral consequences of specific mutations

What is the comparative analysis between loss-of-function and gain-of-function phenotypes of Spastin in Drosophila?

The comparative analysis of loss-of-function and gain-of-function phenotypes provides fascinating insights into Spastin's role in Drosophila development, particularly in photoreceptor morphogenesis:

Loss-of-function phenotypes:

  • Mild mislocalization of the apical membrane domain at the distal section of developing pupal eyes

  • Dramatic reduction or complete loss of the apical domain at the proximal section

  • Specific defects in apical markers including Crumbs (Crb), Stardust (Sdt), and Dpatj

  • Rhabdomere elongation defects similar to those observed in crb and par-1 mutations

Gain-of-function phenotypes:

These contrasting phenotypes suggest that Spastin specifically controls the apical membrane domain during pupal eye development. The fact that overexpression causes apical expansion while loss-of-function causes apical reduction indicates a dose-dependent relationship between Spastin levels and apical domain size .

Intriguingly, in both scenarios, the effects on stable microtubules were less dramatic than the effects on the apical domain, suggesting that Spastin might directly modulate the apical domain, possibly through localized microtubule-severing activity that facilitates targeted membrane trafficking without grossly affecting the main microtubule cytoskeleton .

What experimental approaches are most effective for studying Spastin function in Drosophila models?

Several experimental approaches have proven particularly effective for studying Spastin function in Drosophila:

  • Genetic mosaic techniques: The FLP/FRT-based genetic mosaic technique allows generation of spastin mutant clones in specific tissues, facilitating analysis of cell-autonomous effects in otherwise normal animals . This approach has been instrumental in revealing the role of Spastin in photoreceptor development.

  • Targeted gene expression: The GAL4/UAS system enables tissue-specific overexpression or knockdown of Spastin. Eye-specific GAL4 lines like GMR-GAL4 have been used to study the effects of Spastin overexpression in photoreceptors .

  • Transgenic rescue experiments: Expression of wild-type or mutant Spastin transgenes in spastin null backgrounds allows evaluation of functional conservation between species and assessment of specific domain functions. Pan-neuronal expression of transgenes can rescue behavioral phenotypes like eclosion rates .

  • Immunostaining and confocal microscopy: These techniques are essential for analyzing subcellular localization of Spastin and its effects on cellular structures. In pupal eye development, they reveal Spastin's enrichment in stable microtubules and the apical membrane domain .

  • Trans-heterozygous combinations: Creating flies with different combinations of spastin alleles (e.g., catalytic mutations with potential modifiers) allows investigation of genetic interactions relevant to human disease .

These approaches can be combined with biochemical assays of microtubule severing activity and behavioral assessments to provide a comprehensive understanding of Spastin function in vivo.

What are the critical quality control parameters for recombinant Spastin preparations?

When preparing or using recombinant Drosophila Spastin for research applications, several quality control parameters must be monitored to ensure reliable experimental results:

  • Protein purity: Recombinant Spastin preparations should achieve >90% purity as determined by SDS-PAGE analysis . Contaminating proteins may interfere with functional assays or introduce artifacts.

  • Protein integrity: Western blotting with specific antibodies should confirm the expected molecular weight and absence of significant degradation products. For full-length Drosophila melanogaster Spastin (1-758 amino acids), the expected molecular weight should account for the additional His-tag .

  • ATPase activity: Since Spastin's function depends on ATP hydrolysis, measuring ATPase activity provides a functional quality check. The K388R mutation serves as a negative control, as it abolishes ATPase activity .

  • Microtubule-severing activity: In vitro microtubule-severing assays using purified microtubules and recombinant Spastin can directly assess the protein's primary function. Active Spastin should cause observable microtubule disruption, while catalytically inactive variants (K388R) should associate with microtubules without severing them .

  • Storage stability: Monitoring protein activity after various storage conditions is essential for establishing optimal handling protocols. Repeated freeze-thaw cycles should be avoided as they significantly reduce activity .

How can researchers effectively compare Spastin function across different Drosophila species?

To effectively compare Spastin function across different Drosophila species (such as D. melanogaster and D. virilis), researchers should consider the following methodological approaches:

  • Sequence alignment and structural analysis: Comprehensive alignment of Spastin protein sequences from different Drosophila species can identify conserved domains and species-specific variations. The AAA domain and microtubule-binding regions are likely to be highly conserved, while other regions may show greater divergence.

  • Cross-species rescue experiments: Testing whether Spastin from one species can rescue phenotypes in mutants of another species provides functional evidence of conservation. Similar to experiments showing human Spastin can rescue D. melanogaster spastin mutants , researchers could express D. virilis Spastin in D. melanogaster spastin nulls to assess functional equivalence.

  • Domain swap experiments: Creating chimeric proteins with domains from different species' Spastin can help identify regions responsible for species-specific functions or interactions.

  • Comparative phenotypic analysis: Parallel analysis of loss-of-function and gain-of-function phenotypes in different Drosophila species can reveal conserved and divergent aspects of Spastin function. Particular attention should be paid to developmental processes known to involve Spastin, such as photoreceptor morphogenesis.

  • Biochemical activity comparisons: In vitro comparison of ATPase and microtubule-severing activities of recombinant Spastin from different species under identical conditions can quantify functional differences.

This multi-faceted approach allows researchers to distinguish conserved core functions from species-specific adaptations in Spastin biology.

How can Drosophila Spastin models advance our understanding of neurodegenerative disease mechanisms?

Drosophila Spastin models offer unique advantages for understanding neurodegenerative disease mechanisms, particularly hereditary spastic paraplegia (HSP):

  • Genetic tractability: The ease of creating specific genetic combinations in Drosophila allows researchers to study complex interactions between disease-causing mutations and potential modifiers. This has already yielded insights into how the S44L and P45Q variants modify the effects of catalytic domain mutations .

  • Developmental insights: Studying Spastin's role in developmental processes like photoreceptor morphogenesis reveals fundamental cellular mechanisms that may be disrupted in disease. The requirement for Spastin in apical domain maintenance during cell elongation may have parallels in the maintenance of long axons in human corticospinal tracts affected in HSP.

  • Conserved disease mechanisms: The functional conservation between human and Drosophila Spastin means that insights from fly models are likely relevant to human disease. Both loss-of-function and dominant-negative mechanisms implicated in human HSP can be modeled and distinguished in Drosophila .

  • Cellular readouts: Drosophila models provide clear cellular phenotypes—such as apical domain reduction, microtubule disorganization, and synapse abnormalities—that can serve as readouts for testing therapeutic interventions.

  • Behavioral correlates: The progressive mobility defects in Spastin mutant flies mirror the key clinical feature of HSP, providing a system for studying disease progression and potential treatments.

By integrating findings from these models with human genetic and clinical data, researchers can develop more comprehensive understanding of disease mechanisms and identify new therapeutic targets.

What biochemical assays are most informative for characterizing Spastin activity in vitro?

Several biochemical assays are particularly informative for characterizing Spastin activity in vitro:

  • ATPase activity assays: Measuring ATP hydrolysis rates provides a quantitative measure of Spastin's enzymatic activity. This can be performed using colorimetric assays that detect inorganic phosphate release or coupled enzyme assays with ATP regeneration systems.

  • Microtubule-severing assays: Direct visualization of fluorescently labeled microtubules before and after Spastin addition allows assessment of severing activity. Time-lapse microscopy can capture the dynamics of this process, revealing both the rate and pattern of severing events.

  • Microtubule binding assays: Co-sedimentation assays can determine the affinity of Spastin for microtubules. This is particularly useful for comparing wild-type Spastin with mutant variants, as some mutations (like K388R) affect severing activity but not binding to microtubules .

  • Oligomerization studies: Size-exclusion chromatography or analytical ultracentrifugation can assess the oligomeric state of Spastin under different conditions. This is relevant because AAA proteins typically function as hexameric rings.

  • Substrate specificity assays: Testing Spastin activity on microtubules with different post-translational modifications can reveal preferences for specific microtubule subpopulations, providing insights into its cellular targeting.

These assays should be performed with both wild-type and disease-associated mutant forms of Spastin to understand how mutations affect specific aspects of protein function.

What are the emerging technologies for studying Spastin dynamics in live organisms?

Emerging technologies are revolutionizing the study of Spastin dynamics in live organisms, offering unprecedented insights into its function:

  • Optogenetic control of Spastin activity: Light-inducible Spastin variants allow temporal and spatial control of microtubule severing in vivo. This approach enables precise perturbation of Spastin activity during specific developmental events or in defined cellular compartments.

  • Live imaging of Spastin-microtubule interactions: Fluorescently tagged Spastin combined with labeled microtubules allows real-time visualization of Spastin localization and activity in developing tissues. This can be particularly informative during dynamic processes like photoreceptor elongation, where Spastin regulates the apical domain .

  • CRISPR-based genetic tagging: Endogenous tagging of Spastin using CRISPR/Cas9 enables visualization of the protein at physiological expression levels, avoiding artifacts associated with overexpression systems.

  • Single-molecule tracking: Advanced microscopy techniques allow tracking of individual Spastin molecules in living cells, revealing the dynamics of its association with microtubules and other cellular structures.

  • Biosensors for Spastin activity: Developing FRET-based biosensors that report on Spastin's conformational changes during ATP binding and hydrolysis could provide spatial maps of Spastin activity in vivo.

These technologies, combined with the genetic advantages of Drosophila models, offer powerful approaches for understanding the dynamic functions of Spastin in development and disease.

Comparison of Wild-Type and Mutant Spastin Phenotypes in Drosophila Models

GenotypeEclosion RateApical Domain (Distal)Apical Domain (Proximal)MobilityReference
Wild-type100%NormalNormalNormal
spastin null<6%Reduced (50±10%)Absent (0%)Progressive defects
Human WT Spastin in null~50%RescuedRescuedImproved
D. melanogaster WT Spastin in null~50%RescuedRescuedImproved
K388R Spastin in nullPartial rescuePartially rescuedPartially rescuedPartial improvement
WT + K388R in nullIntermediateAberrantAberrantIntermediate
S44L or P45Q heterozygotesNear normalNear normalNear normalNear normal
S44L or P45Q + K388RExacerbatedExacerbatedExacerbatedExacerbated
Spastin overexpressionReducedExpanded (300±100%)Expanded (300±100%)Abnormal

Protocol Parameters for Recombinant Spastin Handling and Storage

ParameterRecommended ConditionNotesReference
Storage temperature (lyophilized)-20°C to -80°CAliquoting necessary for multiple use
Reconstitution solutionDeionized sterile waterConcentration: 0.1-1.0 mg/mL
Long-term storage additiveGlycerolFinal concentration: 5-50%
Storage bufferTris/PBS-based buffer, 6% TrehalosepH 8.0
Working aliquot storage4°CUp to one week
Freeze-thaw cyclesAvoid repeated cyclesPrepare multiple small aliquots
SDS-PAGE purity standard>90%For functional studies
Pre-use preparationBrief centrifugationEnsures content is at vial bottom

These comprehensive tables provide researchers with quick reference guides for experimental design and interpretation when working with Drosophila Spastin models and recombinant proteins. The phenotypic data highlights the functional conservation between species and the effects of disease-associated mutations, while the handling parameters ensure optimal protein quality for experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.