Recombinant Drosophila willistoni Calcium channel flower (flower)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
flower; GK20652; Calcium channel flower
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Drosophila willistoni (Fruit fly)
Target Names
flower
Target Protein Sequence
MSFAEKITGLLARPNQQQDPAGGPEAPWYLKYGSRLLGIVGAFFAILFGLWNVLSIITLS VSCLVAGIIQMIAGFVVMALEAPCCFVCIDQVNVMADKLDAKPMYFRAGLYCALAVPPIF MCFGLASLFGSGLIFATGVVYGMMALGKKASAADMRAAAQQTDYGGNAATSQAATTSDRA GIVNNAQPFSFTGAVGTDSNV
Uniprot No.

Target Background

Function
Recombinant *Drosophila willistoni* Calcium channel flower (flower) is a calcium channel regulating synaptic endocytosis, coupling exo- and endocytosis. It is essential for nervous system function and photoreceptor cell activity.
Database Links
Protein Families
Calcium channel flower family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.

Q&A

How does the flower protein function in calcium channel regulation?

The flower protein functions as a component of calcium channels that regulate calcium influx into cells. In Drosophila, calcium channels play critical roles in:

  • Synaptic transmission and neurotransmitter release

  • Membrane excitability in neurons

  • Developmental signaling pathways

  • Muscle contraction regulation

Research indicates that calcium channel proteins like flower are involved in fast, calcium-triggered neurotransmitter release at synapses . Unlike some calcium channels that require interactions with specific synaptic proteins, the flower protein may operate through alternative mechanisms for coupling calcium influx to cellular responses. The protein contains domains that respond to membrane potential changes and facilitate calcium ion movement across the membrane, contributing to the diverse conductances, kinetics, and pharmacological sensitivities observed in calcium channels .

How are recombinant Drosophila proteins typically produced for research purposes?

Production of recombinant Drosophila proteins, including the D. willistoni flower protein, typically follows these methodological steps:

  • Gene cloning:

    • PCR amplification of the target gene from D. willistoni genomic DNA or cDNA

    • Insertion into an appropriate expression vector with a promoter and tag sequence

  • Expression system selection:

    • Bacterial systems (E. coli) for non-glycosylated proteins

    • Insect cell systems (Sf9, S2) for proteins requiring post-translational modifications

    • Mammalian cells for complex proteins requiring specific folding

  • Protein expression and purification:

    • Culture growth and induction of protein expression

    • Cell lysis and initial clarification

    • Affinity chromatography using the protein tag (often His-tag)

    • Further purification via ion exchange or size exclusion chromatography

  • Quality control:

    • SDS-PAGE analysis for purity

    • Western blotting for identity confirmation

    • Mass spectrometry for sequence verification

    • Functional assays for activity assessment

The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise protein integrity .

How does the flower protein in D. willistoni compare to orthologs in other Drosophila species?

The flower protein shows considerable conservation across Drosophila species while exhibiting species-specific variations. Comparative analysis reveals:

SpeciesSimilarity to D. willistoni flowerKey DifferencesEvolutionary Implications
D. melanogaster~85% sequence identityVariations in transmembrane domainsFunctional conservation with species-specific adaptations
D. simulans~83% sequence identityDifferences in C-terminal regionRecent divergence patterns
D. virilis~75% sequence identityMore divergent N-terminal regionLonger evolutionary separation
D. mojavensis~78% sequence identityVariations in calcium-binding domainsAdaptation to different ecological niches

Orthologous flower proteins are present across multiple Drosophila species including D. ananassae, D. grimshawi, D. erecta, D. mojavensis, D. virilis, D. simulans, D. persimilis, D. sechellia, and D. yakuba . The conservation of this calcium channel across diverse Drosophila species suggests its fundamental importance in neurophysiology while variations may reflect adaptations to different environmental conditions or behavioral requirements.

What evolutionary patterns are observed in calcium channel genes across Drosophila species?

Evolutionary analysis of calcium channel genes in Drosophila reveals several important patterns:

  • Selective pressure: Calcium channel genes often show evidence of positive selection in different Drosophila lineages, suggesting adaptive evolution .

  • Gene duplication and acquisition: In contrast to mammals, where Y chromosomes evolved primarily through gene loss, Drosophila species show significant gene acquisition through duplication events. For example, in D. willistoni, there's a ratio of gene gains to losses of approximately 25:1 .

  • Segmental duplications: Research has identified large segmental duplications (ranging from 62 kb to 303 kb) from autosomal regions to the Y chromosome in D. willistoni. These duplications have transferred multiple genes, including some involved in calcium regulation .

  • Functional conservation with sequence divergence: Despite sequence differences, calcium channel function appears conserved across species. For instance, the Dmca1A gene in D. melanogaster (homologous to calcium channel genes in other species) maintains similar roles in neurotransmitter release despite sequence evolution .

  • Alternative splicing contribution: Calcium channel diversity is enhanced through alternative splicing, which varies across species, creating functional diversity beyond what is encoded at the genomic level .

These evolutionary patterns suggest that calcium channel genes are subject to both conservation of critical functions and adaptive evolution in response to specific environmental or behavioral pressures.

What are the optimal methods for assessing calcium channel flower functionality in Drosophila models?

Assessing calcium channel flower functionality requires a multi-faceted approach:

  • Electrophysiological methods:

    • Patch-clamp recordings to measure calcium currents in neurons or muscle cells

    • Cell-attached patch-clamp studies to identify currents with variable properties

    • Whole-cell calcium current measurements to assess channel kinetics and conductance

  • Calcium imaging techniques:

    • Fluorescent calcium indicators (e.g., Fluo-4, Fura-2) to visualize calcium flux

    • Genetically encoded calcium indicators (GCaMPs) expressed in specific tissues

    • Time-lapse confocal microscopy to track calcium dynamics

  • Pharmacological approaches:

    • Channel blockers (e.g., phenylalkylamines, dihydropyridines) to assess specific channel types

    • Application of spider toxins like HoTX to differentiate channel subtypes

    • Reconstitution of membrane extracts into artificial bilayers to measure conductance levels

  • Genetic manipulation strategies:

    • RNAi knockdown of flower gene expression using the GAL4/UAS system

    • Temperature-sensitive mutants to allow acute perturbation of channel function

    • CRISPR/Cas9 gene editing to introduce specific mutations

Temperature-sensitive paralytic mutants provide a valuable tool for acute perturbation of calcium channel function, allowing researchers to distinguish between direct effects and long-term compensatory changes that might occur in null or hypomorphic mutants .

How can researchers effectively use ELISA techniques with recombinant D. willistoni flower protein?

When utilizing ELISA techniques with recombinant D. willistoni flower protein, researchers should follow these methodological guidelines:

  • Assay design considerations:

    • Direct ELISA: Coat plates with purified recombinant flower protein (optimal concentration: 1-5 μg/ml)

    • Sandwich ELISA: Use capture antibodies specific to conserved regions of the flower protein

    • Competitive ELISA: For quantifying flower protein in complex biological samples

  • Protocol optimization:

    • Buffer selection: Tris-based buffers (pH 7.4-8.0) maintain protein integrity

    • Blocking agents: 3-5% BSA often provides lower background than milk proteins

    • Antibody dilutions: Titrate primary antibodies (typically 1:500-1:5000) for optimal signal-to-noise ratio

    • Detection systems: HRP-conjugated secondary antibodies with TMB substrate offer good sensitivity

  • Quality control measures:

    • Include recombinant protein standards of known concentration (50-500 ng/ml range)

    • Run intra-assay replicates (minimum n=3) for statistical validity

    • Include negative controls (buffer only) and non-specific protein controls

  • Data analysis:

    • Use four-parameter logistic regression for standard curve fitting

    • Calculate coefficient of variation (acceptable range: <15%)

    • Determine limit of detection and quantification for each assay batch

  • Troubleshooting common issues:

    • High background: Increase blocking time/concentration or add 0.05% Tween-20 to wash buffer

    • Poor sensitivity: Consider signal amplification systems or fluorescent detection

    • Cross-reactivity: Pre-absorb antibodies with related proteins from other Drosophila species

When stored properly (Tris-based buffer with 50% glycerol at -20°C), the recombinant protein remains stable for ELISA applications over several months .

How does the flower gene interact with other components of calcium signaling pathways in neural development?

The flower gene participates in complex interaction networks with other calcium signaling components:

  • Developmental timing of expression: Northern blot analysis of calcium channel genes shows that expression peaks during specific developmental stages - first larval instar, midpupal, and late pupal stages - suggesting coordinated regulation with other neurodevelopmental processes .

  • Interaction with synaptic machinery: Unlike some calcium channels that interact with synaptic proteins through specialized domains, the flower protein may use alternative mechanisms for coupling calcium influx to synaptic vesicle fusion. This suggests unique protein-protein interactions distinct from other calcium channel types .

  • Regulatory pathway integration:

    • Modulation by second messenger systems (cAMP, PKA)

    • Influence of calcium-dependent protein kinases

    • Feedback regulation through calmodulin and calcium-binding proteins

  • Compensatory mechanisms: In genetic studies, when one calcium channel is disrupted, others may show compensatory changes in expression or function, indicating regulatory cross-talk between different channel types .

  • Tissue-specific interaction networks: Expression in the embryonic nervous system suggests specialized interactions with neuron-specific proteins and developmental regulators .

A comprehensive interactome study would require techniques like proximity labeling (BioID), co-immunoprecipitation followed by mass spectrometry, or yeast two-hybrid screening to identify the complete set of protein interactions.

What role does the flower calcium channel play in Drosophila behavior and physiological responses?

The flower calcium channel contributes significantly to Drosophila behavior and physiology through its role in neural signaling:

  • Courtship and mating behaviors: Calcium channels, including flower, are implicated in sex-specific circuits that control courtship behaviors. For example, mutations in calcium channel genes can affect:

    • Male courtship rituals

    • Pheromone detection and processing

    • Sex-specific behaviors mediated by fruitless (fru) gene expression

  • Sensory processing: Calcium channels participate in:

    • Olfactory information processing, including detection of chemosensory cues like DMDS (dimethyl disulfide)

    • Visual processing pathways, with mutations in calcium channel genes causing phenotypes like "nightblind-A"

    • Mechanosensation and proprioception

  • Motor function and coordination: Research with temperature-sensitive paralytic mutants of calcium channel genes demonstrates their critical role in:

    • Neuromuscular transmission

    • Motor coordination

    • Rapid paralysis upon channel dysfunction

  • Response to environmental stimuli: Calcium channel genes show adaptation to:

    • Temperature extremes

    • Nutritional stress conditions

    • Host plant chemical compounds in specialist Drosophila species

  • Developmental processes: The regulated expression of calcium channel genes during specific developmental stages suggests roles in:

    • Nervous system formation

    • Circuit refinement during metamorphosis

    • Synapse maturation and pruning

Understanding these functions requires integrating genetic approaches with behavioral assays and physiological recordings to connect molecular mechanisms to organismal phenotypes.

How do mutations in the flower gene affect calcium channel function and what are the physiological consequences?

Mutations in the flower gene can significantly alter calcium channel function with cascade effects on physiology:

  • Types of mutations and their effects:

Mutation TypeMolecular EffectPhysiological Consequence
Missense mutations in transmembrane domainsAltered ion selectivity or gatingChanged calcium flux kinetics leading to synaptic transmission defects
Mutations in regulatory domainsDisrupted calcium-dependent regulationInability to modulate channel activity in response to cellular signals
Splice site mutationsAltered isoform expressionTissue-specific functional deficits
Null mutationsComplete loss of proteinSevere phenotypes including potential lethality
  • Documented phenotypic effects:

    • Temperature-sensitive paralysis: Mutations in calcium channel genes can cause rapid paralysis at elevated temperatures due to disruption of neurotransmitter release

    • Behavioral abnormalities: Altered courtship, feeding, or locomotor behaviors

    • Developmental defects: Changes in neural circuit formation or function

    • Electrophysiological changes: Altered calcium current amplitude, kinetics, or voltage-dependence

  • Compensatory mechanisms:

    • Upregulation of other calcium channel subtypes

    • Changes in synaptic protein expression

    • Altered dendritic or axonal morphology

  • Species-specific effects: The consequences of flower mutations may differ between Drosophila species due to variations in genetic background and evolutionary adaptations. What causes a severe phenotype in one species might have milder effects in another due to compensatory genetic mechanisms .

Studies of temperature-sensitive mutations in calcium channel genes provide particularly valuable insights, as they allow for acute perturbation of channel function and direct observation of the resultant physiological effects without the confounding influence of developmental compensation .

What are the best approaches for studying alternative splicing of the flower gene in D. willistoni?

Studying alternative splicing of the flower gene requires specialized techniques:

  • RNA sequencing approaches:

    • Long-read sequencing (PacBio or Oxford Nanopore) to capture full-length transcripts

    • RNA-seq using tissue-specific libraries, particularly from neural tissues

    • Targeted sequencing of flower gene transcripts using amplicon-based methods

    • Nanopore direct RNA sequencing to detect modifications and exact splice junctions

  • PCR-based methods:

    • RT-PCR with primers flanking known or predicted splice junctions

    • Nested PCR for low-abundance transcripts

    • Quantitative RT-PCR to measure relative abundance of specific isoforms

    • Digital droplet PCR for absolute quantification of transcript variants

  • Splice junction analysis:

    • Minigene constructs to test specific splicing events in vivo

    • CRISPR/Cas9 editing of splicing regulatory elements

    • RNA immunoprecipitation to identify splicing factors binding to flower pre-mRNA

  • Visualization techniques:

    • Fluorescent reporters linked to specific splice variants

    • Single-molecule RNA FISH to detect specific isoforms in situ

Research on calcium channel genes in Drosophila has demonstrated that alternative splicing generates transcript diversity, with functional consequences for channel properties . For the flower gene, analysis should focus on developmental stage-specific and tissue-specific alternative splicing patterns, as calcium channel expression is known to be regulated during critical developmental periods .

How can researchers effectively design CRISPR/Cas9 experiments to study flower gene function in D. willistoni?

Designing effective CRISPR/Cas9 experiments for the D. willistoni flower gene requires careful planning:

  • Target selection and gRNA design:

    • Target conserved functional domains (transmembrane regions, ion selectivity filter)

    • Use D. willistoni genome sequence to design species-specific gRNAs

    • Employ multiple prediction algorithms to identify optimal targets (high efficiency, low off-targets)

    • Consider targeting splice sites to generate alternative transcripts

  • Delivery methods:

    • Embryo microinjection of Cas9 protein and gRNA complexes

    • Transgenic expression of Cas9 and gRNA using GAL4/UAS system

    • Tissue-specific or inducible Cas9 expression for conditional knockouts

  • Screening strategies:

    • High-resolution melt analysis (HRMA) for initial mutation detection

    • T7 endonuclease assay to detect indels

    • Direct sequencing of PCR products from genomic DNA

    • Phenotypic screening for expected calcium channel dysfunction

  • Experimental design considerations:

    • Include appropriate controls (non-targeting gRNAs, wild-type comparisons)

    • Generate multiple independent mutant lines to control for off-target effects

    • Consider creating specific mutations to study structure-function relationships

    • Design rescue experiments with wild-type or mutant transgenes

  • Functional validation approaches:

    • Calcium imaging to assess channel function

    • Electrophysiological recording of calcium currents

    • Behavioral assays for neural function

    • Developmental phenotyping to identify subtle effects

For precision engineering, homology-directed repair (HDR) templates can be co-delivered with CRISPR components to introduce specific mutations or fluorescent tags to study protein localization and dynamics.

What are the major challenges in expressing and purifying functional recombinant D. willistoni flower protein?

Expressing and purifying functional calcium channel proteins presents several technical challenges:

  • Expression system limitations:

    • Bacterial systems often fail to properly fold complex transmembrane proteins

    • Insect cell systems may provide better folding but lower yields

    • Mammalian cells offer proper folding but are more expensive and time-consuming

  • Solubility and membrane protein handling:

    • Calcium channel proteins are highly hydrophobic and prone to aggregation

    • Detergent selection is critical for maintaining functional state

    • Lipid environments must be optimized to maintain native structure

  • Common challenges and solutions:

ChallengeTechnical SolutionSuccess Indicators
Protein aggregationUse mild detergents (DDM, LMNG); add stabilizing agentsMonodisperse peak on size exclusion chromatography
Low expression levelsOptimize codon usage; use stronger promoters; lower expression temperatureVisible band on Western blot; improved yield quantification
Improper foldingInclude molecular chaperones; use fusion partners (MBP, SUMO)Functional activity in calcium flux assays
Proteolytic degradationAdd protease inhibitors; engineer out vulnerable sitesSingle band on SDS-PAGE; intact mass by MS
Difficult purificationOptimize tag position; use tandem affinity purification>90% purity on SDS-PAGE
  • Quality control approaches:

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Functional assays in reconstituted liposomes

    • Limited proteolysis to evaluate folding state

  • Storage recommendations:

    • Avoid repeated freeze-thaw cycles

    • Store in Tris-based buffer with 50% glycerol

    • Maintain at -20°C for short-term or -80°C for long-term storage

For calcium channel flower protein specifically, expression of individual domains may be more successful than full-length protein for structural and interaction studies.

How can researchers address data reproducibility issues in calcium channel studies across different Drosophila species?

Ensuring reproducibility in calcium channel studies across Drosophila species requires addressing several methodological challenges:

  • Standardization of experimental conditions:

    • Precise developmental staging: A 24-hour age difference can result in differential expression of over 2000 genes in Drosophila

    • Consistent rearing conditions: Temperature, humidity, photoperiod, and diet composition

    • Standardized genetic backgrounds: Backcrossing to control for genetic modifiers

    • Defined experimental protocols: Detailed methods sharing including specific buffer compositions

  • Genetic considerations:

    • Account for species-specific genetic variations

    • Control for potential Wolbachia infections, which can affect approximately 10-20% of Drosophila species and influence experimental outcomes

    • Document strain origins and maintenance history

    • Use multiple independent transgenic or mutant lines

  • Technical approaches to improve reproducibility:

    • Blind analysis of experimental data

    • Increased biological and technical replicates

    • Power analysis to determine appropriate sample sizes

    • Pre-registration of experimental designs and analysis plans

  • Data sharing recommendations:

    • Deposit raw data in public repositories

    • Share detailed protocols including specific reagents

    • Adopt common data formats for electrophysiological recordings

    • Include negative results to address publication bias

  • Species-specific considerations:

    • Account for evolutionary distance between species

    • Validate antibodies and molecular tools for each species

    • Consider different behavioral and physiological baselines

    • Recognize that homologous genes may have evolved different functions

When comparing calcium channel function across species, researchers should acknowledge that genes with similar sequences may have divergent functions due to changes in regulation, protein interactions, or cellular contexts. This evolutionary perspective is essential for correctly interpreting cross-species data .

What are the current gaps in understanding the structure-function relationship of the flower calcium channel?

Despite progress in calcium channel research, several knowledge gaps remain regarding the structure-function relationship of the flower calcium channel:

  • Structural unknowns:

    • High-resolution 3D structure of the complete flower protein is lacking

    • Conformational changes during channel opening/closing are not fully characterized

    • Exact calcium binding sites and their coordination chemistry remain undefined

    • Protein-protein interaction surfaces that regulate channel function are poorly mapped

  • Functional questions:

    • How does flower interact with other calcium channel subunits?

    • What are the precise kinetics of calcium flux through the channel?

    • How is channel activity modulated by cellular signaling pathways?

    • What determines the subcellular localization of the channel?

  • Species-specific adaptations:

    • How do sequence variations between Drosophila species affect channel properties?

    • Do species-specific differences correlate with ecological adaptations or behavioral traits?

    • What selective pressures drive the evolution of calcium channel genes?

  • Methodological limitations:

    • Challenges in expressing and purifying full-length channel for structural studies

    • Difficulty in reconstituting functional channels in artificial membranes

    • Limited ability to measure channel activity in native neuronal contexts

    • Complexity of distinguishing flower-specific currents from other calcium channels

  • Future research directions:

    • Cryo-EM studies of purified channels in native-like lipid environments

    • Molecular dynamics simulations to predict conformational changes

    • Optogenetic tools to specifically activate or inhibit flower channels

    • Comparative functional studies across closely related Drosophila species

Addressing these gaps will require integrating advanced structural biology techniques with functional assays and evolutionary analyses to build a comprehensive understanding of how calcium channel structure relates to its diverse physiological roles in different species and tissues.

How is the flower gene involved in adaptations to environmental stressors in different Drosophila species?

The flower gene and other calcium channel components appear to play significant roles in environmental adaptation:

  • Stress response mechanisms:

    • Nutrient shortage adaptation: Calcium signaling contributes to resistance to malnutrition and starvation through metabolic regulation

    • Temperature adaptation: Calcium channels show altered expression and function in flies adapted to temperature extremes

    • Chemical defense responses: Calcium signaling participates in detoxification of plant compounds encountered by specialist Drosophila species

  • Species-specific adaptations:

    • Cactophilic Drosophila species show specialized calcium channel adaptations that enable survival in toxic host plant environments

    • D. willistoni lineage-specific calcium channel variations may contribute to its ecological niche adaptation

    • Comparative studies reveal that calcium channel genes often display the strongest genome-wide signals of recent selection within D. melanogaster populations

  • Molecular mechanisms of adaptation:

    • Standing genetic variation appears to be the primary substrate for calcium channel adaptation rather than de novo mutations

    • Recent analysis suggests that chemosensory systems, which often involve calcium signaling, show strong signals of adaptive evolution

    • Some calcium channel genes appear to be under balancing selection, maintaining polymorphism in populations

  • Research approaches:

    • Population genomics to identify signatures of selection on calcium channel genes

    • Functional assays comparing channel properties between adapted populations

    • Genetic manipulation to test specific adaptive hypotheses

    • Ecological studies connecting molecular adaptations to fitness in natural environments

The flower gene may contribute to these adaptations through changes in expression patterns, protein sequence, or regulatory interactions that modify calcium signaling properties in response to environmental challenges.

What insights have recent genomic and transcriptomic studies provided about flower gene regulation and expression?

Recent genomic and transcriptomic approaches have revealed several key insights about calcium channel gene regulation:

  • Expression dynamics:

    • Developmental regulation: Calcium channel gene expression shows peaks at specific developmental stages (first larval instar, midpupal, and late pupal stages)

    • Tissue specificity: Preferential expression in the nervous system during late embryonic stages

    • Sex-specific patterns: Some calcium channel genes show sexually dimorphic expression patterns related to sex-specific behaviors

  • Regulatory mechanisms:

    • Alternative splicing generates diversity: Variant transcripts of calcium channel genes are produced through alternative splicing events

    • RNA editing: Single nucleotide variations between cDNAs and genomic sequence suggest RNA editing contributes to functional diversity

    • Enhancer redundancy: Studies of other Drosophila genes reveal that multiple enhancer elements often drive overlapping expression patterns, suggesting complex regulatory architecture

  • Genomic organization insights:

    • Enhancer evolution: Rapid evolution of genomic organization has been observed in Drosophila genes, with regulatory elements found in different genomic locations across species

    • Cryptic enhancers: Some regulatory elements drive expression patterns not seen in native contexts, suggesting repressed enhancer activities that might contribute to evolutionary innovation

    • Transposable elements: In some Drosophila genes, transposable element insertions influence gene expression through methylation and other mechanisms

  • Comparative findings:

    • Species-specific regulation: Different Drosophila species show distinct regulatory mechanisms for calcium channel genes

    • Conserved core functions: Despite regulatory differences, calcium channel genes maintain core functional roles across species

    • Rapid regulatory evolution: Gene regulation appears to evolve more rapidly than coding sequences in some cases

These findings suggest that the flower gene likely has complex regulatory mechanisms that contribute to its proper expression in specific tissues and developmental contexts, with potential for evolutionary innovation through changes in regulatory architecture.

How might research on D. willistoni flower protein contribute to understanding human calcium channelopathies?

Research on the D. willistoni flower calcium channel has translational potential for understanding human calcium-related disorders:

  • Conserved functional mechanisms:

    • Fundamental aspects of calcium channel function are conserved from Drosophila to humans

    • Insights into gating, ion selectivity, and regulation from Drosophila studies can inform human channel research

    • Structure-function relationships identified in flower protein may apply to homologous human channels

  • Model system advantages:

    • Drosophila allows rapid genetic manipulation not possible in human studies

    • The simplicity of fly systems facilitates mechanistic insights that would be obscured in more complex mammalian models

    • Temperature-sensitive mutations provide unique tools to study acute channel dysfunction relevant to episodic human disorders

  • Potential applications to human disorders:

Human Calcium ChannelopathyRelevant Drosophila ResearchTranslational Potential
Familial hemiplegic migraineTemperature-sensitive calcium channel mutants Understanding triggers and mechanisms of episodic symptoms
Episodic ataxiaEffects of specific mutations on channel functionRational drug design targeting specific channel domains
Certain forms of epilepsySynaptic transmission studies in calcium channel mutantsIdentification of compensatory mechanisms that could be therapeutic targets
Neurodevelopmental disordersDevelopmental roles of calcium channels in neural circuit formationInsights into critical periods for intervention
  • Drug discovery applications:

    • Drosophila models for high-throughput screening of compounds affecting calcium channels

    • Structure-based design of modulators targeting specific channel conformations

    • Identification of genetic modifiers that could represent therapeutic targets

  • Limitations and considerations:

    • Evolutionary distance between Drosophila and humans

    • Differences in physiological contexts and modulatory mechanisms

    • Species-specific protein interactions that may not be conserved

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.