Recombinant Drosophila willistoni Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila willistoni Spastin (spas)

Recombinant Drosophila willistoni Spastin (spas) is a partial recombinant protein derived from the fruit fly Drosophila willistoni. This protein is produced through recombinant DNA technology, where the gene encoding spastin is inserted into a host organism, such as Escherichia coli (E. coli) or baculovirus, to express the protein . Spastin is a microtubule-severing enzyme that plays a crucial role in maintaining microtubule dynamics, which are essential for cellular processes like cell division, intracellular transport, and synaptic function .

Characteristics of Recombinant Drosophila willistoni Spastin (spas)

  • Purity and Source: The recombinant protein has a purity of more than 85% as determined by SDS-PAGE and is sourced from either E. coli or baculovirus .

  • Uniprot Number: The Uniprot number for this protein is B4NBP4 .

  • Storage and Shelf Life: The shelf life varies depending on storage conditions. Generally, the liquid form lasts for six months at -20°C/-80°C, while the lyophilized form can last up to 12 months under the same conditions .

Microtubule Dynamics

Spastin is known to sever microtubules, which is crucial for maintaining microtubule dynamics and stability. This activity is essential for cellular processes such as axonal transport and synaptic function . In Drosophila, spastin has been shown to regulate synaptic microtubule networks and influence neurotransmitter release .

Implications in Neurological Disorders

Mutations in spastin lead to impaired microtubule severing, contributing to axonal degeneration and neurological disorders like HSP . Understanding the function of spastin and its mutants can provide insights into potential therapeutic strategies for these conditions.

Table 1: Characteristics of Recombinant Drosophila willistoni Spastin (spas)

CharacteristicDescription
Purity>85% (SDS-PAGE)
SourceE. coli or Baculovirus
Uniprot NumberB4NBP4
Shelf Life (Liquid)6 months at -20°C/-80°C
Shelf Life (Lyophilized)12 months at -20°C/-80°C

Table 2: Functions and Implications of Spastin

Function/ImplicationDescription
Microtubule SeveringEssential for microtubule dynamics and stability
Role in Neurological DisordersAssociated with hereditary spastic paraplegia (HSP)
Cellular ProcessesInfluences axonal transport and synaptic function

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
spas; GK11148; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-777
Protein Length
full length protein
Species
Drosophila willistoni (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKSSSSSASSSSQKSPIKSNNGAGGGGSSSSHRQSHRTSIDERKSSSHAHSNNSNVS SSSRRAATATSGSSSPEGDDDTTTDDLTPTGSSPRSCNGRGHSSVHKQNLYVVSFPIIFL FNVLRSLIYQLFCIFRYLYGASTKVLYRPHRRDCNIEIVVQNSKEQQLQLQQHQHNQTLS YSLETGGVSGGSGGEQQVQVQPQRIRALQPLEMATNRPGGGYSPGPGDPLLAKQKHHHRR AFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWNGRGDVWDRAQRLHDKMQ TNLSMARDRLHFLALREEDLQMQRLSLKEKQPAPKQPQRSQTKDPVKQPMLTSLNADPVK MKVRSSGYGPKQNGTSSSRPAPSGQTATGASGRKLTVGTKRPGNLPVTNKSQTLPRNLGS KTTVGAVQRQPAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNASSGSGASTPMVSVKGV EQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLL FGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFI DEVDSLLSERSSNEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRR FTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITEGYSGSDLTALAKDAALE PIRELNVEQVKCLDISAMRPITEKDFHNSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function

Recombinant Drosophila willistoni Spastin (spas) is an ATP-dependent microtubule-severing protein. It stimulates microtubule minus-end depolymerization and poleward microtubule flux within the mitotic spindle. Furthermore, it regulates microtubule stability at the neuromuscular junction synapse, plays a role in lipid metabolism by influencing lipid droplet size and distribution, and contributes to axon regeneration through its regulation of microtubule severing.

Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is the enzymatic classification and primary function of Drosophila willistoni Spastin?

Drosophila willistoni Spastin (spas) is classified as an AAA-ATPase enzyme (EC 3.6.4.3) that functions as a microtubule-severing protein . Recent research has revealed that spastin is actually a dual-function enzyme. Beyond its well-known ATP-dependent severing activity, spastin also serves as an ATP-independent regulator of microtubule dynamics that can slow microtubule shrinkage and increase rescue frequency . This dual functionality explains the paradoxical observation that inhibiting spastin in vivo often decreases rather than increases microtubule numbers.

What are the optimal storage conditions for maintaining recombinant Spastin activity?

Recombinant Drosophila willistoni Spastin should be stored at -20°C/-80°C to maximize shelf life, which is typically 6 months for liquid formulations and 12 months for lyophilized preparations . For working solutions, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a cryoprotectant . For short-term use, working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can diminish enzymatic activity .

How does the structure of Drosophila Spastin compare to human Spastin?

Drosophila and human Spastin show significant functional conservation. Human Spastin can rescue behavioral and cellular defects in Drosophila spastin null flies as effectively as the Drosophila version, indicating structural and functional homology between the species . Both proteins contain a crucial ATPase domain with a Walker B motif required for catalytic activity. The critical K388 residue in Drosophila Spastin (equivalent to R388 when mutated) is essential for nucleotide binding and ATPase activity . This conservation makes Drosophila Spastin an excellent model for studying human Spastin function and disease-causing mutations.

How can recombinant Spastin be used to study microtubule dynamics in vitro?

To study Spastin's dual effects on microtubule dynamics:

  • Reconstitution assay setup: Combine fluorescently labeled tubulin with dynamic microtubule seeds in a flow chamber with GTP.

  • Addition protocol: Add recombinant Spastin at varying concentrations (typically 5-50 nM).

  • Imaging parameters: Use time-lapse fluorescence microscopy at 1-5 second intervals.

  • Analysis metrics: Measure:

    • Severing frequency (breaks per microtubule length per time)

    • Growth/shrinkage rates (μm/min)

    • Rescue frequency (transitions from shrinkage to growth per unit time)

    • Catastrophe frequency (transitions from growth to shrinkage per unit time)

This approach has revealed that Spastin accumulates at shrinking microtubule ends, slowing shrinkage and increasing rescue frequency, which promotes microtubule regrowth after severing .

What controls should be included when analyzing Spastin's microtubule severing activity?

For rigorous analysis of Spastin's severing activity, include:

  • Negative controls:

    • Buffer-only control (no Spastin)

    • Heat-inactivated Spastin (95°C for 5 minutes)

    • Spastin-E442Q mutant (Walker B motif mutation abolishing ATPase activity)

  • Positive controls:

    • Fresh recombinant Spastin with confirmed activity

    • Alternative severing enzyme (katanin or fidgetin) if available

  • Experimental variations:

    • ATP concentration series (0-5 mM)

    • Spastin concentration series (1-100 nM)

    • Pre-stabilized vs. dynamic microtubules

When evaluating results, monitoring both the frequency of severing events and the post-severing microtubule dynamics is essential for capturing Spastin's dual functionality .

How can Drosophila models be used to validate recombinant Spastin activity?

Validating recombinant Spastin activity in Drosophila systems can be accomplished through:

Successful activity should mirror published phenotypes showing that functional Spastin disrupts the microtubule cytoskeleton when overexpressed .

How can the ATP-dependent and ATP-independent functions of Spastin be experimentally distinguished?

Differentiating between Spastin's dual functions requires carefully designed experiments:

  • ATP-dependent severing activity:

    • Use real-time microscopy to visualize microtubule severing events

    • Quantify severing in the presence of ATP

    • Compare with non-hydrolyzable ATP analogs (ATP-γ-S)

    • Test E442Q mutant Spastin that lacks ATPase activity

  • ATP-independent regulation of dynamics:

    • Measure microtubule growth/shrinkage rates and rescue/catastrophe frequencies in:
      a) ATP-free conditions
      b) With Spastin carrying the E442Q mutation

    • Analyze Spastin accumulation at microtubule ends using fluorescently tagged protein

  • Comparative analysis:

    • Plot concentration-dependent effects for both functions

    • Perform mathematical modeling to determine how these functions interact

Mathematical modeling has shown that Spastin's effect on dynamics is essential for its nucleation-like activity, as it switches microtubules to a state with positive net tubulin flux onto each polymer .

What methodological approaches can distinguish between dominant negative and haploinsufficiency mechanisms in disease models?

To experimentally differentiate between dominant negative and haploinsufficiency mechanisms:

  • Transgenic models:

    • Create flies expressing combinations of wild-type and mutant Spastin:
      a) One copy wild-type + one copy K388R catalytic domain mutation
      b) Heterozygous truncation mutants

  • Quantitative assays:

    • Compare phenotype severity between:
      a) Spastin nulls (complete loss)
      b) Heterozygous expression of mutant forms
      c) Co-expression of wild-type and mutant forms

  • Subcellular localization analysis:

    • Track wild-type Spastin (cytoplasmic aggregates) vs. R388 mutant (filamentous pattern along bundled microtubules)

    • Determine if mutant and wild-type proteins co-localize

  • Microtubule binding competition assays:

    • Test if mutant Spastin competes with wild-type for microtubule binding sites

Research using these approaches supports both mechanisms: dominant negative effects where R388 mutant Spastin associates with bundled microtubules without severing them, and haploinsufficiency supported by the absence of truncated protein variants in patients with early termination codon mutations .

How does Spastin interact with other microtubule-regulating proteins in neuronal systems?

Studying Spastin's interactions with other neuronal microtubule regulators requires:

  • Co-immunoprecipitation approaches:

    • Pull down Spastin and probe for associated proteins

    • Confirm interactions with reciprocal co-IPs

  • Genetic interaction experiments:

    • Test double mutants of Spastin and:
      a) Futsch/MAP1B (a downstream effector of BMP signaling)
      b) dFMRP (Drosophila Fragile X Mental Retardation Protein)
      c) Spartin (another HSP protein that regulates microtubule stability)

  • Pathway analysis:

    • Assess BMP signaling (via phosphorylated Mad levels)

    • Test rescue of phenotypes using the microtubule-destabilizing drug vinblastine

  • Live imaging in neurons:

    • Visualize EB1-GFP comet density and dynamic behavior

    • Compare wild-type, Spastin knockdown, and Spastin overexpression conditions

Research has established that Spartin regulates synaptic development and neuronal survival by controlling microtubule stability via the BMP-dFMRP-Futsch pathway, which may intersect with Spastin function . Additionally, Spastin KD decreased microtubule comet density in SVP+ regions while Spastin overexpression disrupted normal microtubule comet positioning .

What factors might affect the stability and enzymatic activity of recombinant Spastin?

Factors affecting recombinant Spastin stability and activity include:

FactorImpactMitigation Strategy
Storage temperatureHigher temperatures accelerate activity lossStore at -80°C; avoid frequent freeze-thaw cycles
Buffer compositionInappropriate salt or pH reduces activityUse optimized buffer (typically 50 mM HEPES pH 7.4, 150 mM NaCl)
Protein concentrationDilute solutions lose activity fasterStore at higher concentration with glycerol (5-50%)
Post-translational modificationsLack of critical modifications in E.coli-expressed proteinConsider expression in eukaryotic systems for certain applications
NeddylationCan target Spastin for degradationConsider using neddylation inhibitors

Research has shown that Spastin levels can be regulated by neddylation-mediated degradation, with K554 being a key ubiquitination site . Additionally, HIPK2 has been identified as a regulator of Spastin protein levels in the CNS .

How can contradictory results between in vitro and in vivo Spastin studies be reconciled?

Reconciling seemingly contradictory results requires considering:

  • Concentration-dependent effects:

    • Both overexpression and loss of Spastin-M1 can result in similar phenotypes

    • Titrate expression levels carefully in experiments

  • Isoform-specific functions:

    • Different Spastin isoforms (M1 vs. M87) have distinct localizations and functions

    • Spastin-M1 localizes to ER and lipid droplets

    • Spastin-M87 is the major isoform expressed in cells and tissues

  • Dual functionality paradigm:

    • Integrate both severing activity and effects on microtubule dynamics

    • Consider that severing creates new microtubule ends that can then grow

    • Mathematical modeling shows that Spastin's effect on dynamics is essential for its nucleation-like activity

  • Subcellular context:

    • Spastin localization differs within cellular compartments

    • Spastin KD and OE have opposite effects on microtubule comet density in different cellular regions

Understanding Spastin as a dual-function enzyme has resolved the paradox where inhibiting severing enzymes in vivo decreases rather than increases microtubule numbers .

What experimental approaches can determine if a novel Spastin variant affects its function?

To characterize novel Spastin variants:

  • In vitro biochemical characterization:

    • Express and purify recombinant wild-type and variant Spastin

    • Measure ATPase activity using malachite green phosphate assay

    • Conduct microtubule severing assays with fluorescently labeled microtubules

    • Analyze microtubule binding affinity using co-sedimentation assays

  • Cell-based functional assays:

    • Express variants in spastin-null cell lines

    • Quantify rescue of:
      a) Lipid droplet biogenesis and TAG accumulation
      b) Microtubule organization and dynamics

  • Drosophila model validation:

    • Generate transgenic flies expressing variants

    • Test rescue of eclosion rates (wildtype achieves ~50% rescue)

    • Analyze NMJ morphology and function

    • Assess behavior using climbing assays

    • Examine progressive neurodegeneration (brain vacuolization)

  • Modifier screens:

    • Test interactions with known modifiers such as S44L and P45Q, which exacerbate catalytic domain mutations when expressed in trans

This methodology successfully identified that the K554R mutation renders Spastin resistant to degradation in HIPK2-defective cells .

How might recombinant Spastin be used to study lipid droplet biogenesis and metabolism?

Emerging research shows Spastin's involvement in lipid metabolism can be studied through:

  • Lipid droplet assays:

    • Treat cells with oleic acid to induce lipid droplet formation

    • Compare PLIN2-labeled structures in wild-type vs. Spastin knockout cells

    • Rescue experiments using different Spastin isoforms (M1 vs. M87)

    • Quantify triglyceride (TAG) levels by mass spectrometry

  • Microtubule-dependent vs. independent functions:

    • Use E442Q mutant to distinguish ATP-dependent severing from other functions

    • Compare effects of wild-type and E442Q mutant Spastin on TAG accumulation

    • Visualize lipid droplet distribution and clustering using PLIN2 staining

  • Isoform-specific roles:

    • Express different isoforms with modified Kozak sequences:
      a) Endogenous Kozak (eKozak) - produces mostly M87
      b) Good Kozak (gKozak) - produces mostly M1

    • Compare effects on lipid droplet biogenesis and distribution

Research has shown that lack of Spastin-M1 leads to increased lipid droplet biogenesis (MT-independent) and failure to disperse lipid droplets upon glucose deprivation (MT-dependent) .

What mathematical models best describe Spastin's effects on microtubule network dynamics?

Mathematical modeling of Spastin's dual functions requires:

  • Parameter measurement:

    • Determine key parameters experimentally:
      a) Severing frequency as a function of Spastin concentration
      b) Effects on growth/shrinkage rates and rescue/catastrophe frequencies
      c) Spastin binding and dissociation rates

  • Network simulation components:

    • Integrate dual Spastin functions:
      a) ATP-dependent severing creating new microtubule ends
      b) ATP-independent effects on microtubule dynamics

    • Account for Spastin concentration at microtubule ends

  • Validation metrics:

    • Compare model predictions with experimental measurements of:
      a) Microtubule mass over time
      b) Length distribution
      c) Number of microtubules

Mathematical modeling has demonstrated that Spastin's effect on microtubule dynamics is essential for its nucleation-like activity, as it switches microtubules to a state with positive net tubulin flux, leading to exponential increase in microtubule mass .

A combination of experimental approaches and mathematical modeling has been instrumental in resolving the paradox where severing enzymes, despite their destructive name, actually increase microtubule mass in vivo .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.