Recombinant Drosophila yakuba Adenosine monophosphate-protein transferase FICD homolog (GE13868)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila yakuba Adenosine Monophosphate-Protein Transferase FICD Homolog (GE13868)

The Recombinant Drosophila yakuba Adenosine monophosphate-protein transferase FICD homolog (GE13868) is a recombinant protein derived from the fruit fly species Drosophila yakuba. This protein is homologous to FICD, which stands for "filamentation induced by cyclic AMP" domain-containing protein, known for its role in AMPylation, a post-translational modification process. AMPylation involves the transfer of an adenosine monophosphate (AMP) moiety from ATP to a protein substrate, which can alter the function or localization of the target protein.

Characteristics of Recombinant Drosophila yakuba Adenosine Monophosphate-Protein Transferase FICD Homolog (GE13868)

  • Species: Drosophila yakuba (Fruit fly)

  • Uniprot Number: B4P0E1

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for this protein.

  • Storage Conditions: Store at -20°C for extended storage or conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended.

  • Working Aliquots: Store at 4°C for up to one week.

  • Quantity: Available in quantities of 50 µg; other quantities available upon inquiry.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GE13868; Protein adenylyltransferase Fic; De-AMPylase Fic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
full length protein
Species
Drosophila yakuba (Fruit fly)
Target Names
GE13868
Target Protein Sequence
MGTEAEQPSPPSPPAQQQEQTNPPLWNAQNQKPARLYRLVLFFIAGSLAAWTIHALSNSN LVWKLRQLHHLPTAHYLQTRDEFAVYSVEELNAFKEIYDKSVSDSVGASYTKDEQTSINE ALVSLRMAQDMYLAGKDDKASRLFEHALALAPRHPEVLLRYGEFLEHSQRNIVLADQYYF QALTISPSNSEALANRQRTADVVQTLDERRLQSLDSKRDALSAIHESNGALRRAKKEAYF QHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDI TIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRFERWLNSEHSST LHPVNYAALAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRNKYYHFLKL ANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQR SSILEFYESGSGALP
Uniprot No.

Target Background

Function

This protein acts as a dual-function enzyme, mediating both the addition (AMPylation) and removal (de-AMPylation) of adenosine 5'-monophosphate (AMP) to/from target proteins. The Glu-250 residue dictates whether AMPylation or de-AMPylation occurs. It plays a crucial regulatory role in the unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation of Hsc70-3/BiP. Under normal cellular conditions, it functions as an adenylyltransferase, AMPylating Hsc70-3/BiP at Thr-518, thus inactivating it. In response to endoplasmic reticulum stress, it switches to a phosphodiesterase activity, removing AMP from Hsc70-3/BiP at Thr-518, restoring HSPA5/BiP activity.

Database Links
Protein Families
Fic family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the evolutionary context of Drosophila yakuba and how does it influence studies of GE13868?

Drosophila yakuba belongs to the melanogaster subgroup, specifically within the yakuba species complex that includes D. yakuba, D. santomea, and D. teissieri. These three species share identical mitochondrial genomes despite nuclear differentiation, creating a unique evolutionary model . This mitochondrial genome conservation across species with nuclear divergence has significant implications for studying nuclear-encoded mitochondrial proteins like FICD homologs.

The methodological approach to studying this protein should consider the complex evolutionary history of D. yakuba, particularly its recombination landscape which differs significantly from other Drosophila species. Nearly 35.3% of the D. yakuba genome has low numbers of segregating sites, extending from telomeres and centromeres to regions that typically show high recombination in D. melanogaster . Additionally, D. yakuba exhibits high polymorphism for large chromosomal inversions that suppress recombination, with research identifying at least five inversions polymorphic in D. yakuba populations .

When designing experiments involving GE13868, researchers should account for these genomic characteristics, as they may influence gene expression patterns, protein function, and evolutionary constraints on adenosine monophosphate-related enzymes.

How do adenosine monophosphate enzymes function in Drosophila and what experimental approaches are most effective for their study?

Adenosine monophosphate-related enzymes play critical roles in energy metabolism in Drosophila species. While specific information about FICD homolog is limited in the search results, related enzymes like AMPD1 provide insight into effective research approaches. AMPD1 catalyzes the conversion of adenosine monophosphate (AMP) to inosine monophosphate (IMP), a key reaction in nucleotide metabolism .

The recommended methodological pipeline for studying AMP-related enzymes includes:

  • Gene cloning: Amplify the gene of interest from cDNA libraries using PCR with primers containing appropriate restriction sites for subsequent cloning .

  • Expression vector construction: Clone the amplified gene into eukaryotic expression vectors like pEGFP-C3 to create fusion proteins that facilitate visualization and functional studies .

  • Transient transfection: Introduce the recombinant construct into appropriate cell lines (e.g., 293T cells) using reagents like Lipofectamine, typically using 1.0 μg of cDNA per 150,000 cells .

  • Subcellular localization analysis: Visualize the expressed protein using techniques like confocal microscopy to determine its cellular distribution, which provides insight into potential function .

When applying these approaches to FICD homolog (GE13868), researchers should optimize conditions based on the specific characteristics of this protein, considering factors like codon usage, protein size, and potential post-translational modifications.

What is the significance of mitochondrial genome recombination in Drosophila yakuba for studies of nuclear-encoded mitochondrial proteins?

Understanding mitochondrial genome recombination in Drosophila yakuba has profound implications for research on nuclear-encoded mitochondrial proteins like FICD homolog. While homologous recombination in animal mitochondrial DNA was previously questioned, research now provides clear evidence for homologous genetic exchange between Drosophila mitochondrial genomes under various conditions .

This recombination capability influences experimental approaches in several ways:

  • Heteroplasmic considerations: When studying nuclear-encoded mitochondrial proteins, researchers should consider potential interactions with different mitochondrial genome variants that may coexist within cells .

  • Selection-based experimental design: Recombination events may be difficult to detect without selection, as physical assays without selective pressure have failed to detect recombination at levels below 1 in 1000 . Designing experiments with selective advantages for particular genetic combinations can reveal otherwise undetectable recombination events.

  • Cross-species implications: Recombination has been observed even between diverged genomes like D. melanogaster and D. yakuba (which share about 93% sequence identity in coding regions) . This raises important considerations for evolutionary studies of nuclear-encoded mitochondrial proteins across species.

The ability to map traits to particular regions of the mitochondrial genome through recombination analysis provides a valuable tool for understanding the functional interaction between nuclear-encoded proteins and their mitochondrial partners .

How can researchers optimize expression systems for recombinant Drosophila yakuba FICD homolog in experimental settings?

Optimizing expression systems for the recombinant Drosophila yakuba FICD homolog requires consideration of multiple factors to ensure proper folding, post-translational modifications, and functional activity. Based on methodologies developed for related proteins, researchers should implement a multi-faceted approach:

  • Expression vector selection: For subcellular localization studies, vectors like pEGFP-C3 enable creation of fluorescent fusion proteins . For purification purposes, vectors with affinity tags (His, GST, MBP) may be more appropriate. Consider the position of tags (N- or C-terminal) based on the protein's functional domains.

  • Host system optimization:

    • Mammalian cells (e.g., 293T cells) grown in DMEM with 10% fetal calf serum provide a eukaryotic environment suitable for proper folding and post-translational modifications .

    • Insect cell systems (Sf9, Sf21, High Five) may offer advantages for expression of Drosophila proteins.

    • Bacterial systems may be suitable for structural studies but may lack post-translational modifications.

  • Transfection/transformation parameters:

    • For mammalian cells, lipid-based transfection with approximately 1.0 μg of DNA per 150,000 cells has proven effective for similar proteins .

    • Optimize DNA:transfection reagent ratios through systematic testing.

    • Consider stable cell line generation for consistent expression levels.

  • Expression verification protocols:

    • Fluorescence microscopy for tagged proteins

    • Western blotting with antibodies against the protein or tag

    • Enzymatic activity assays specific to adenosine monophosphate-protein transferase function

The choice of expression system should ultimately be guided by the experimental objectives, whether structural characterization, functional analysis, or interaction studies.

What molecular mechanisms govern the interaction between adenosine monophosphate-protein transferases and energy metabolism pathways in Drosophila yakuba?

Adenosine monophosphate-protein transferases interact with energy metabolism pathways through complex regulatory networks. While specific information about FICD homolog (GE13868) is limited in the search results, related research on AMP metabolism provides valuable insights into potential mechanisms:

  • AMPK signaling interface: AMP-activated protein kinase (AMPK) functions as a central energy sensor that responds to changes in cellular AMP levels. When activated, AMPK increases ATP production and decreases ATP consumption by enhancing glycolysis and inhibiting protein synthesis, thus affecting the formation of IMP and potentially the activity of AMP-protein transferases .

  • mTOR pathway interactions: The mechanistic target of rapamycin (mTOR) functions downstream of AMPK. Research shows that AMPK directly phosphorylates raptor and blocks the ability of the mTOR kinase complex to phosphorylate its substrates . This regulatory network likely influences the activity of AMP-related enzymes including FICD homologs.

  • Ribosomal protein synthesis linkage: One of the mTOR targets, p70S6K1, enhances the translation function of pyrimidine mRNA, thereby affecting ATP metabolism . This creates a potential feedback loop between protein synthesis, energy metabolism, and AMP-related enzymatic activities.

A comprehensive experimental approach to elucidating these mechanisms should include:

  • Phosphorylation state analysis using phospho-specific antibodies

  • Protein-protein interaction studies using co-immunoprecipitation or proximity labeling

  • Metabolic flux analysis to track adenosine nucleotide conversion pathways

  • Genetic manipulation of pathway components to assess effects on FICD homolog activity

How do genomic inversions and recombination landscapes in Drosophila yakuba influence the evolution and function of GE13868?

The unique genomic architecture of Drosophila yakuba, characterized by extensive inversions and distinctive recombination patterns, significantly impacts the evolution and function of nuclear-encoded genes like GE13868:

  • Recombination suppression effects: D. yakuba exhibits high polymorphism for large chromosomal inversions that typically suppress recombination . This recombination suppression can lead to the accumulation of outlier genes in specific genomic regions, potentially affecting the evolutionary trajectory of genes encoding metabolic enzymes.

  • Population-specific variation: Research has identified multiple inversions that are polymorphic in D. yakuba populations, with some inversions being specific to and nearly fixed in certain populations like D. y. mayottensis . This population structure may lead to differential selection pressures on metabolic enzymes across populations.

  • Genomic islands of divergence: Studies have identified genomic islands of divergence (GIDs) between D. yakuba populations, some of which coincide with inversion breakpoints while others occur in regions without structural rearrangements . These GIDs may harbor genes under selection, potentially including those involved in energy metabolism.

FeatureD. yakubaD. melanogasterPotential impact on GE13868
Low recombination regions35.3% of genomeLower percentagePotential accumulation of adaptive or deleterious mutations
Common inversionsMultiple polymorphic inversionsFewer inversionsPossible population-specific functional variants
Recombination suppressionExtensiveMore limitedLinkage disequilibrium affecting selection on GE13868

Understanding these genomic features is essential for interpreting patterns of genetic variation in GE13868 across populations and for designing experiments that account for potential population structure effects.

What methodological approaches are most effective for studying the functional consequences of mutations in the FICD homolog in Drosophila yakuba?

To comprehensively assess the functional consequences of mutations in the FICD homolog, researchers should implement a multi-level experimental approach:

  • CRISPR/Cas9-mediated genome editing:

    • Design guide RNAs targeting specific regions of the GE13868 gene

    • Generate precise mutations to alter key functional domains

    • Create complete knockout lines for loss-of-function analysis

  • Phenotypic characterization protocols:

    • Developmental timing analysis across life stages

    • Lifespan and stress resistance assays

    • Metabolic profiling using liquid chromatography-mass spectrometry (LC-MS)

    • Mitochondrial function assessment (oxygen consumption, membrane potential)

  • Molecular function assessment:

    • Enzymatic activity assays for AMP-protein transferase function

    • Protein-protein interaction studies using co-immunoprecipitation or yeast two-hybrid approaches

    • Subcellular localization analysis of mutant proteins

    • Structural analysis through circular dichroism or crystallography

  • Heteroplasmic background testing:

    • Evaluate mutation effects in the context of different mitochondrial genomes

    • Induce mitochondrial recombination through double-strand breaks to map functional interactions

    • Cross mutant lines with different Drosophila yakuba populations to assess genetic background effects

The selection-based approach demonstrated for mitochondrial genome recombination could serve as a powerful model for revealing functional consequences that might be subtle under standard laboratory conditions . By designing selective conditions that specifically challenge the function of the FICD homolog, researchers can identify even minor functional alterations resulting from mutations.

How can interspecies hybridization experiments with Drosophila yakuba inform our understanding of FICD homolog function?

Interspecies hybridization experiments offer unique insights into the function and evolution of FICD homolog by leveraging the natural genetic variation between closely related species. Research on the yakuba species complex provides a methodological framework for such studies:

The ability to create viable hybrids between D. yakuba and related species provides a powerful platform for studying the functional evolution of nuclear-encoded mitochondrial proteins in different genetic backgrounds, potentially revealing adaptations specific to each species' ecological niche.

What protocols yield optimal results for recombinant expression and purification of Drosophila yakuba FICD homolog?

Based on methodologies developed for related proteins, the following optimized protocol is recommended for expression and purification of Drosophila yakuba FICD homolog:

  • Molecular cloning strategy:

    • Amplify the FICD homolog open reading frame from D. yakuba cDNA using high-fidelity polymerase

    • Design primers incorporating appropriate restriction sites for directional cloning

    • PCR conditions: 95°C for 30s, 58°C for 1 min, and 72°C for 2 min, for 30 cycles

    • Clone the amplified product into an expression vector with appropriate affinity tag

  • Expression system optimization:

    • For subcellular localization studies: Use mammalian cells (293T) with pEGFP-C3 vector to create fluorescent fusion proteins

    • For protein purification: Consider insect cell expression systems (Sf9, Sf21) with baculovirus vectors

    • Culture 293T cells in DMEM supplemented with 10% fetal calf serum and antibiotics (500 μ/ml penicillin, 500 U/ml streptomycin)

  • Transfection and expression:

    • Transfect cells using Lipofectamine according to manufacturer's protocol

    • Use approximately 1.0 μg of cDNA per 150,000 cells in 6-well plates

    • Incubate for 48-72 hours post-transfection for optimal protein expression

  • Purification strategy:

    • Harvest cells and prepare lysates under conditions that maintain protein stability

    • Perform affinity chromatography using the incorporated tag

    • Consider additional purification steps (ion exchange, size exclusion) based on protein characteristics

    • Verify purity by SDS-PAGE and protein identification by Western blot or mass spectrometry

  • Functional verification:

    • Develop enzymatic assays specific to AMP-protein transferase activity

    • Assess protein folding through circular dichroism or thermal shift assays

    • Perform subcellular localization studies if using fluorescent fusion proteins

This systematic approach provides a robust framework that can be optimized based on specific experimental objectives and protein characteristics.

How can researchers effectively analyze recombination events in Drosophila yakuba mitochondrial genomes when studying nuclear-encoded proteins?

Analyzing recombination events in Drosophila mitochondrial genomes provides valuable insights into mitochondrial-nuclear interactions relevant to nuclear-encoded proteins like FICD homolog. Based on successful research approaches, the following methodology is recommended:

  • Heteroplasmic line creation:

    • Generate D. yakuba lines carrying two different mitochondrial genomes with distinguishable genetic markers

    • Design mitochondrial genomes with different restriction sites (e.g., one lacking BglII site, another lacking XhoI site)

    • Maintain heteroplasmic lines under conditions that stabilize the presence of both genomes

  • Selection system implementation:

    • Design selection schemes where recombinant mitochondrial genomes would have an advantage

    • Consider that without selection, recombination events below 1 in 1000 may be undetectable by standard methods

    • Apply selective pressure that favors particular combinations of mitochondrial alleles

  • Double-strand break induction:

    • Express restriction enzymes targeted to mitochondria (e.g., mito-BglII and mito-XhoI) to induce double-strand breaks

    • Target breaks to specific locations to promote recombination in regions of interest

    • Control expression temporally using inducible systems

  • Recombination detection and characterization:

    • Perform Southern blot analysis using appropriate restriction enzymes to detect fragments of unexpected sizes

    • Use PCR with primers flanking potential recombination sites

    • Apply next-generation sequencing to comprehensively characterize recombinant genomes

    • Map crossover points by analyzing the distribution of sequence polymorphisms

  • Functional correlation:

    • Analyze how recombinant mitochondrial genomes interact with nuclear-encoded proteins

    • Assess phenotypic consequences of mitochondrial recombination

    • Use recombination mapping to identify mitochondrial regions functionally interacting with specific nuclear genes

This methodological framework not only enables detection of mitochondrial recombination but also provides a powerful tool for dissecting mitochondrial-nuclear interactions relevant to proteins like FICD homolog.

What techniques are most effective for studying the biochemical activity and substrate specificity of Drosophila yakuba FICD homolog?

To comprehensively characterize the biochemical activity and substrate specificity of Drosophila yakuba FICD homolog, researchers should employ a multi-faceted approach combining in vitro and cellular techniques:

  • Enzymatic activity assays:

    • Develop assays measuring adenosine monophosphate transfer to protein substrates

    • Monitor reaction progress through techniques such as radioisotope labeling, fluorescence, or mass spectrometry

    • Determine kinetic parameters (Km, Vmax, kcat) through systematic substrate concentration variation

    • Compare activity with orthologs from related species to identify evolutionary changes in catalytic efficiency

  • Substrate identification methodology:

    • Perform protein microarray screening with purified FICD homolog to identify potential substrates

    • Use proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling in cells

    • Conduct immunoprecipitation followed by mass spectrometry to identify interacting proteins

    • Validate candidate substrates through in vitro AMP-transferase assays

  • Structure-function analysis:

    • Generate site-directed mutants of conserved catalytic residues

    • Assess the impact of mutations on enzymatic activity and substrate binding

    • Perform comparative structural analysis with homologs from other species

    • Use molecular docking to predict substrate binding modes

  • Cellular context evaluation:

    • Express wild-type and mutant versions in appropriate cell lines

    • Assess subcellular localization through fluorescent fusion proteins

    • Analyze the impact of FICD homolog expression on cellular energy metabolism

    • Investigate how enzymatic activity responds to changes in cellular energy status

  • Integration with signaling pathways:

    • Examine interactions with energy-sensing pathways including AMPK and mTOR

    • Investigate how post-translational modifications affect enzymatic activity

    • Determine how substrate selection changes under different metabolic conditions

This comprehensive approach will provide insights into both the basic biochemical properties of the enzyme and its biological role in cellular energy metabolism.

How has the FICD homolog evolved across the Drosophila yakuba species complex, and what does this reveal about protein function?

The evolution of FICD homolog across the Drosophila yakuba species complex offers valuable insights into protein function and adaptation. While specific information about GE13868 is limited in the search results, the evolutionary patterns of the yakuba complex provide a framework for analysis:

  • Mitochondrial genome conservation patterns:

    • The yakuba species complex (D. yakuba, D. santomea, and D. teissieri) shares identical mitochondrial genomes despite nuclear differentiation

    • This pattern suggests strong selection pressure maintaining mitochondrial sequence conservation

    • Nuclear-encoded mitochondrial proteins like FICD homolog may show corresponding conservation in regions interfacing with mitochondrial factors

  • Nuclear differentiation implications:

    • Despite mitochondrial genome conservation, these species show clear nuclear differentiation

    • Analysis of nuclear-encoded mitochondrial proteins may reveal adaptive changes that maintain functional compatibility with the conserved mitochondrial genome

    • Regions of FICD homolog not directly interacting with mitochondrial components may show greater evolutionary divergence

  • Reproductive isolation mechanisms:

    • Research has characterized six isolating mechanisms maintaining species boundaries in the yakuba complex

    • Proteins involved in these reproductive isolation mechanisms often show accelerated evolution

    • Comparing evolutionary rates across protein domains may reveal functionally important regions

  • Hybridization potential:

    • The ability of these species to hybridize in laboratory conditions, producing fertile female hybrids , creates opportunities for studying functional compatibility of FICD variants

    • Protein function in hybrid backgrounds can reveal dominant/recessive relationships between variants

    • Assessing hybrid fitness in relation to energy metabolism could highlight the functional significance of FICD homolog variations

The shared mitochondrial background across these species creates a natural experiment for studying how nuclear-encoded mitochondrial proteins evolve to maintain functional compatibility with the mitochondrial genome while potentially adapting to species-specific requirements.

What comparative genomic approaches reveal functional constraints on Drosophila adenosine monophosphate-related enzymes?

Comparative genomic approaches provide powerful insights into functional constraints on adenosine monophosphate-related enzymes in Drosophila species, highlighting evolutionary pressures that shape these important metabolic components:

  • Recombination landscape analysis:

    • The recombination landscape in D. yakuba differs significantly from other Drosophila species, with nearly 35.3% of the genome having low recombination rates

    • Genes located in regions with different recombination rates may experience different evolutionary pressures

    • Comparing adenosine monophosphate-related enzymes across these regions can reveal differential constraints

  • Genomic islands of divergence (GIDs):

    • Studies have identified GIDs between D. yakuba populations, some coinciding with inversion breakpoints

    • Analysis of whether AMP-related enzymes like FICD homolog fall within these GIDs can indicate selective pressures

    • Positive vs. negative Population Branch Excess (PBE) values associated with GIDs containing metabolic enzymes can suggest adaptive evolution

  • Chromosomal inversion patterns:

    • D. yakuba is highly polymorphic for large chromosomal inversions that suppress recombination

    • Comparing the genomic context of AMP-related enzymes relative to these inversions across populations can reveal functional constraints

    • Inversions specific to particular populations may contain locally adapted variants of metabolic genes

  • Cross-species sequence conservation:

    • Patterns of sequence conservation in coding vs. non-coding regions

    • Identification of conserved functional domains vs. variable regions

    • Signatures of selection (dN/dS ratios) across different lineages

These comparative approaches, when applied to FICD homolog and related enzymes, can identify functionally critical regions that maintain consistent selective pressure across evolutionary time, distinguishing them from regions experiencing lineage-specific adaptation.

How do mitochondrial-nuclear interactions influence the function of recombinant FICD homolog in different genetic backgrounds?

Mitochondrial-nuclear interactions significantly impact the function of nuclear-encoded mitochondrial proteins like FICD homolog across different genetic backgrounds. Research on Drosophila mitochondrial genetics provides key insights into these dynamics:

  • Mitochondrial genome conservation:

    • The yakuba species complex (D. yakuba, D. santomea, and D. teissieri) shares identical mitochondrial genomes despite nuclear differentiation

    • This pattern suggests co-evolution between nuclear and mitochondrial genomes to maintain functional compatibility

    • Nuclear-encoded proteins targeting mitochondria likely face selective pressure to maintain functional interactions with the mitochondrial genome

  • Recombination dynamics:

    • Homologous recombination occurs in Drosophila mitochondrial genomes, as demonstrated by selection experiments

    • Recombination can be enhanced by double-strand breaks and occurs in both germline and somatic cells

    • The distribution of sequence polymorphisms in recombinants can be used to map traits to particular regions in the mitochondrial genome

  • Cross-species compatibility:

    • Recombination has been observed between diverged genomes like D. melanogaster and D. yakuba, which share about 93% sequence identity in coding regions

    • This suggests functional compatibility between nuclear factors and diverged mitochondrial sequences

    • Nuclear-encoded mitochondrial proteins may contain domains with differential tolerance for interaction with diverged mitochondrial components

  • Experimental approaches to study these interactions:

    • Create heteroplasmic lines with different mitochondrial genomes

    • Express recombinant FICD homolog in backgrounds with different mitochondrial compositions

    • Apply selection pressure to reveal functional interactions that might be masked under standard conditions

    • Use mitochondrial recombination mapping to identify specific interactions between FICD homolog and mitochondrial components

Understanding these interactions is essential for interpreting the function of recombinant FICD homolog in different experimental systems and for predicting how genetic variation might impact protein function in natural populations.

What emerging technologies will advance our understanding of adenosine monophosphate-protein transferases in Drosophila species?

Several cutting-edge technologies promise to significantly advance our understanding of adenosine monophosphate-protein transferases like FICD homolog in Drosophila species:

  • CRISPR-based technologies:

    • Prime editing for precise nucleotide modifications without double-strand breaks

    • Base editing for targeted C-to-T or A-to-G conversions without requiring donor templates

    • CRISPR interference/activation (CRISPRi/CRISPRa) for reversible modulation of gene expression

    • These approaches enable more precise genetic manipulation to study protein function in vivo

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization beyond diffraction limits

    • Live-cell imaging with genetically encoded biosensors to monitor enzyme activity in real-time

    • Correlative light and electron microscopy (CLEM) to link protein localization with ultrastructural context

    • These methods provide unprecedented spatial and temporal resolution of protein function

  • Proteomics advances:

    • Proximity labeling techniques (BioID, APEX) for mapping protein interaction networks in native cellular contexts

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for analyzing protein dynamics and conformational changes

    • Crosslinking mass spectrometry (XL-MS) for capturing transient protein-protein interactions

    • These approaches reveal functional protein networks and structural dynamics

  • Single-cell technologies:

    • Single-cell transcriptomics to analyze cell-type-specific expression patterns

    • Single-cell proteomics to detect protein abundance variations across individual cells

    • Spatial transcriptomics to map gene expression patterns with tissue context

    • These methods capture cellular heterogeneity often masked in bulk analyses

  • Computational approaches:

    • AlphaFold2 and related AI systems for accurate protein structure prediction

    • Molecular dynamics simulations to model enzyme-substrate interactions

    • Network analysis tools to integrate multi-omics datasets

    • These computational tools enable in silico hypothesis generation and testing

Integration of these technologies within a systems biology framework will provide comprehensive understanding of how adenosine monophosphate-protein transferases function within complex cellular networks and how they contribute to organismal physiology.

How might research on Drosophila yakuba FICD homolog contribute to understanding human metabolic disorders?

Research on Drosophila yakuba FICD homolog has significant translational potential for understanding human metabolic disorders through several mechanistic pathways:

  • Conserved AMP metabolism pathways:

    • Adenosine monophosphate metabolism pathways are highly conserved between Drosophila and humans

    • AMPK signaling, which responds to changes in cellular AMP levels, regulates key metabolic processes in both species

    • The mTOR pathway, downstream of AMPK, affects protein synthesis and cell growth in conserved ways

    • Insights from Drosophila enzymes can illuminate fundamental mechanisms relevant to human metabolism

  • Mitochondrial-nuclear interactions:

    • Mitochondrial dysfunction underlies numerous human metabolic disorders

    • Studies of nuclear-encoded mitochondrial proteins in Drosophila provide models for understanding similar interactions in humans

    • The ability to study mitochondrial recombination in Drosophila offers unique insights into mitochondrial genetic mechanisms

  • Protein AMPylation in disease contexts:

    • AMP-protein transferases mediate protein AMPylation, a post-translational modification increasingly recognized in human diseases

    • FICD homologs regulate protein folding and endoplasmic reticulum stress responses

    • Dysregulation of these processes contributes to metabolic disorders, neurodegenerative diseases, and cancer

  • Methodological translations:

    • Genetic manipulation techniques optimized in Drosophila can be adapted for mammalian systems

    • High-throughput screening approaches in Drosophila can identify potential therapeutic targets

    • Structural insights from Drosophila proteins can guide drug design for human orthologs

  • Disease modeling advantages:

    • Drosophila provides a genetically tractable system with rapid generation time

    • Conservation of core metabolic pathways enables modeling of human disease mechanisms

    • The ability to create and analyze large numbers of genetic variants facilitates comprehensive functional analysis impossible in mammalian systems

This translational potential highlights the importance of basic research on model organisms like Drosophila yakuba for advancing our understanding of human metabolic disorders and developing novel therapeutic approaches.

What quality control measures are essential when working with recombinant Drosophila yakuba FICD homolog?

Ensuring the quality and integrity of recombinant Drosophila yakuba FICD homolog requires rigorous quality control measures throughout the experimental workflow:

  • Gene sequence verification:

    • Complete sequencing of the cloned gene to confirm absence of mutations

    • Verification of reading frame integrity, particularly at fusion points with tags

    • Confirmation of promoter and regulatory elements in expression constructs

    • This prevents experimental artifacts due to sequence errors

  • Expression product validation:

    • Western blot analysis to confirm protein size and integrity

    • Mass spectrometry to verify protein identity and detect post-translational modifications

    • Circular dichroism to assess secondary structure content

    • These approaches confirm that the expressed protein maintains its expected characteristics

  • Functional activity assessment:

    • Enzymatic assays specific to adenosine monophosphate-protein transferase activity

    • Comparison with positive controls to confirm activity levels

    • Negative controls using catalytically inactive mutants

    • These tests ensure that the recombinant protein maintains its functional capabilities

  • Subcellular localization confirmation:

    • Confocal microscopy of fluorescent fusion proteins to verify expected localization

    • Co-localization with appropriate subcellular markers

    • Fractionation studies to biochemically confirm localization patterns

    • These approaches verify that the protein reaches its correct cellular destination

  • Stability and storage optimization:

    • Thermal shift assays to determine protein stability under different conditions

    • Optimization of buffer components to enhance long-term stability

    • Assessment of activity retention after freeze-thaw cycles

    • These measures ensure consistent protein quality across experiments

How should researchers address potential confounding factors when studying Drosophila yakuba protein function across different genetic backgrounds?

When studying Drosophila yakuba protein function across different genetic backgrounds, researchers must systematically address several potential confounding factors:

  • Chromosomal inversion effects:

    • D. yakuba is highly polymorphic for chromosomal inversions that suppress recombination

    • Different populations carry distinct inversion patterns that can affect gene expression

    • Generate controlled genetic backgrounds with characterized inversion status

    • Use balancer chromosomes to maintain specific genetic configurations

  • Mitochondrial genome variation:

    • Mitochondrial-nuclear interactions can significantly influence protein function

    • Create isogenic lines where nuclear backgrounds are standardized but mitochondrial genomes vary

    • Consider heteroplasmy effects where multiple mitochondrial genomes coexist

    • Test protein function in backgrounds with different mitochondrial haplotypes

  • Recombination landscape influence:

    • The recombination landscape in D. yakuba differs from other Drosophila species, with 35.3% of the genome having low recombination rates

    • Genes located in regions with different recombination rates may experience different evolutionary pressures

    • Map the genomic location of genes relative to recombination hotspots or coldspots

  • Population structure considerations:

    • D. yakuba populations show significant genetic differentiation, with some inversions specific to certain populations

    • Sample across multiple populations to capture natural variation

    • Implement population structure corrections in statistical analyses

    • Consider local adaptation effects that may influence protein function

  • Experimental design strategies:

    • Use reciprocal crosses to distinguish maternal effects from genetic background effects

    • Implement factorial designs that systematically vary nuclear and mitochondrial backgrounds

    • Include appropriate controls for each genetic background

    • Apply mixed-model statistical approaches that account for genetic relatedness

By systematically addressing these confounding factors, researchers can distinguish true functional characteristics of the FICD homolog from artifacts of genetic background variation, enabling more accurate interpretation of experimental results.

What methodologies enable precise quantification of adenosine monophosphate-protein transferase activity in Drosophila tissues?

Precise quantification of adenosine monophosphate-protein transferase activity in Drosophila tissues requires specialized methodologies that balance sensitivity, specificity, and throughput:

  • Tissue preparation protocols:

    • Flash-freeze tissues immediately after dissection to preserve enzymatic activity

    • Homogenize tissues in buffers optimized to maintain protein stability

    • Include protease inhibitors to prevent protein degradation

    • Perform subcellular fractionation if compartment-specific activity is of interest

  • Activity assay technologies:

    • Radiometric assays using [α-32P]ATP to monitor transfer of radioactive AMP to protein substrates

    • Fluorescence-based assays using modified ATP analogs with fluorescent tags

    • ELISA-based detection of AMPylated proteins using specific antibodies

    • These approaches offer different balances of sensitivity, specificity, and throughput

  • Mass spectrometry-based approaches:

    • Targeted mass spectrometry to quantify AMPylated peptides

    • SWATH-MS (Sequential Window Acquisition of all Theoretical fragment ion spectra) for comprehensive detection

    • Parallel Reaction Monitoring (PRM) for high-sensitivity quantification of specific target sites

    • These methods provide site-specific information about AMPylation events

  • In situ detection methods:

    • Antibodies specific to AMPylated proteins for immunohistochemistry

    • Click chemistry approaches using modified ATP analogs that enable visualization of AMPylation sites

    • Proximity ligation assays to detect interactions between transferases and substrates

    • These techniques preserve spatial information about enzymatic activity

  • Data analysis considerations:

    • Normalize activity measurements to total protein content or tissue weight

    • Include appropriate controls (positive controls, negative controls, heat-inactivated samples)

    • Perform time-course analyses to ensure measurements are made in the linear range

    • Use standard curves with purified enzymes for absolute quantification

The choice of methodology should be guided by the specific research question, with consideration of factors such as sensitivity requirements, need for spatial information, and whether site-specific or global AMPylation data is more relevant to the study objectives.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.