Recombinant Drosophila yakuba ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression

The recombinant form of Drosophila yakuba ATP synthase subunit a is typically produced in Escherichia coli expression systems, which allow for high-yield protein production and simplified purification protocols . The addition of an N-terminal histidine tag enables efficient purification using metal affinity chromatography techniques.

Expression and Purification Parameters

The following table outlines the key parameters for the recombinant production of mt:ATPase6:

ParameterSpecification
Expression SystemE. coli
Protein LengthFull Length (1-224 amino acids)
Fusion TagN-terminal His tag
Purity>90% (determined by SDS-PAGE)
FormLyophilized powder
ApplicationsSDS-PAGE, functional studies
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Table 1: Production parameters for recombinant Drosophila yakuba mt:ATPase6 protein .

Reconstitution and Handling

For optimal results, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (final concentration 5-50%) is recommended for long-term storage, with 50% being the standard concentration for commercial preparations . Once reconstituted, repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week .

Evolutionary Significance

The mt:ATPase6 gene has been extensively studied in evolutionary biology, particularly within the Drosophila genus. Comparative genomic analyses have revealed interesting patterns of conservation and divergence across different Drosophila species.

Evolutionary Conservation Patterns

Sequence analyses comparing D. yakuba with other members of the melanogaster subgroup (including D. melanogaster, D. simulans, and D. mauritiana) have revealed significant insights into the evolutionary history of this protein. D. yakuba diverged from the other three species approximately 6-15 million years ago, while D. melanogaster separated from D. simulans and D. mauritiana about 2-5 million years ago .

The amino acid substitution rates in the ATPase 6 gene appear to vary across different Drosophila species. Notably, some strains of D. melanogaster exhibit higher amino acid substitution rates than D. yakuba and other related species . This pattern suggests differential selective pressures on this gene across the evolutionary history of these fruit flies.

Conserved Functional Domains

When comparing the amino acid sequence of D. yakuba mt:ATPase6 with its counterparts in diverse organisms including yeast, mammals (human, bovine, mouse, and rat), and even the distantly related E. coli, certain regions show remarkable conservation . This conservation highlights the fundamental importance of these regions to the function of the protein across evolutionary time.

The highest degree of conservation is observed in the C-terminal region and particularly within transmembrane helices 4 and 5, which play critical roles in proton translocation . In contrast, the N-terminal region displays relatively weaker homology across different organisms, suggesting this region may be under less stringent functional constraint.

Functional Role in Mitochondrial ATP Synthesis

ATP synthase subunit a forms an integral component of the ATP synthase complex, responsible for the majority of cellular ATP production through oxidative phosphorylation. The functional importance of ATP synthase components is underscored by studies on related subunits in Drosophila, which demonstrate that deficiencies in ATP synthase function can lead to severe developmental abnormalities and reduced viability .

Mechanism of Action

The mt:ATPase6 protein constitutes a critical part of the proton channel in the Fo portion of ATP synthase. This channel allows protons to flow back into the mitochondrial matrix, following the electrochemical gradient established by the electron transport chain. The energy released by this proton flow drives the conformational changes in the F1 portion that catalyze the synthesis of ATP from ADP and inorganic phosphate .

The highly conserved transmembrane helices in mt:ATPase6, particularly helices 4 and 5, are directly involved in proton translocation and are thought to interact with other subunits, including subunit 9, to form the functional proton channel . The precise positioning of these helices is crucial for maintaining the efficiency of the ATP synthesis process.

Research Applications

Recombinant Drosophila yakuba mt:ATPase6 protein has several important applications in biochemical and evolutionary research. The availability of purified recombinant protein facilitates detailed structural and functional analyses that contribute to our understanding of mitochondrial energy metabolism.

Biochemical Studies

The recombinant protein can be used in various biochemical assays to investigate the structure-function relationships of ATP synthase. These include:

  1. Reconstitution studies in liposomes to examine proton translocation activity

  2. Binding assays with other ATP synthase subunits to elucidate protein-protein interactions

  3. Structural analysis using techniques such as X-ray crystallography or cryo-electron microscopy

  4. Enzymatic activity assays to measure ATP hydrolysis capabilities

Evolutionary and Comparative Studies

The availability of recombinant D. yakuba mt:ATPase6 protein also facilitates comparative studies across different Drosophila species and other organisms. Such studies can provide insights into:

  1. The evolution of mitochondrial genes and proteins

  2. The functional consequences of amino acid substitutions that have occurred during evolution

  3. The molecular basis for species-specific differences in mitochondrial function

  4. The mechanisms of co-evolution between nuclear and mitochondrially encoded proteins of the ATP synthase complex

Technical Considerations for Laboratory Use

For researchers working with recombinant D. yakuba mt:ATPase6, several technical considerations should be kept in mind to ensure optimal results.

Quality Control Parameters

Commercial preparations of recombinant D. yakuba mt:ATPase6 typically undergo rigorous quality control testing to ensure high purity and activity. Standard quality control parameters include:

  1. Purity assessment by SDS-PAGE (typically >90%)

  2. Confirmation of molecular weight

  3. Verification of N-terminal His-tag presence

  4. Functional activity testing where applicable

Future Research Directions

Research on Drosophila yakuba mt:ATPase6 continues to evolve, with several promising directions for future investigation:

Functional Characterization

More detailed functional characterization of recombinant D. yakuba mt:ATPase6, particularly regarding its proton translocation capabilities and interactions with other subunits, would contribute significantly to our understanding of mitochondrial energy metabolism. In vitro reconstitution studies with defined lipid compositions could help elucidate the role of the membrane environment in modulating protein function.

Comparative Analyses

Expanded comparative analyses involving mt:ATPase6 from additional Drosophila species and other insects could provide deeper insights into the evolutionary patterns and functional constraints acting on this important mitochondrial protein. Such studies could help identify regions of the protein that are essential for function versus those that can accommodate variation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila yakuba (Fruit fly)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSAIFNLSLNWLSTFLGLLMIPSIYWLMPSRYNIFWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWIN HTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGP SMSYLLVTFLLVAQIALLVLESAVTMIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links

KEGG: dya:ATP6

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How should researchers design mutagenesis studies to understand mt:ATPase6 structure-function relationships?

    A comprehensive mutagenesis approach should include:

    • Sequence alignment across Drosophila species to identify conserved residues

    • Targeted mutagenesis of conserved residues in the proton channel

    • Analysis of interaction sites with other ATP synthase subunits

    • Charge-swap experiments for suspected ion pairs

    • Examination of disease-associated equivalent positions from human studies

    For example, the T8993G mutation in human MT-ATP6 (causing Leigh syndrome) impairs the function of ATP synthase by inhibiting ATP production and disrupting oxidative phosphorylation . Equivalent mutations could be introduced in Drosophila yakuba mt:ATPase6 to study mechanistic conservation and develop disease models.

  • What approaches can be used to study the integration of recombinant mt:ATPase6 into the ATP synthase complex?

    Several complementary techniques provide insights into complex assembly:

    • Blue native PAGE for visualizing intact complexes and subcomplexes

    • Co-immunoprecipitation to identify interaction partners

    • Cross-linking mass spectrometry to map interaction interfaces

    • Förster resonance energy transfer (FRET) to measure proximity between labeled subunits

    • In organello complementation to test functional integration

    These approaches can be combined with site-directed mutagenesis to identify critical residues for assembly and function . For kinetic studies of assembly, pulse-chase experiments with inducible expression systems provide valuable time-resolved data.

  • What methodological considerations are important for structural studies of recombinant mt:ATPase6?

    Structural determination requires careful planning:

    • Protein engineering: Consider fusion partners or antibody fragments to stabilize conformations

    • Sample preparation: Detergent screening, amphipol exchange, or nanodiscs as membrane mimetics

    • Crystallization approaches: Vapor diffusion, lipidic cubic phase, or bicelle methods

    • Cryo-EM optimization: GraFix method for sample homogeneity, Volta phase plates for contrast enhancement

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

    Given the challenges with membrane proteins, a hybrid approach combining lower-resolution cryo-EM with computational modeling and crosslinking data often proves most effective for ATP synthase components.

  • How can researchers investigate the relationship between mt:ATPase6 function and metabolism under stress conditions?

    To investigate metabolic connections, researchers should implement:

    • Metabolomic profiling under conditions of normal versus impaired mt:ATPase6 function

    • 13C-labeled substrate tracing to measure flux through major metabolic pathways

    • Real-time measurement of ATP/ADP ratios using fluorescent biosensors

    • Analysis of compensatory glycolytic upregulation (Warburg effect)

    Research in Drosophila wing development has shown that tissues can enhance glycolytic ATP production when oxidative phosphorylation is inhibited, particularly in regions with high energy demands . The Hedgehog signaling pathway has been demonstrated to enhance ATP production from glycolysis upon loss of oxidative phosphorylation, suggesting important crosstalk between developmental signaling and energy metabolism .

  • What genetic approaches can be applied to study mt:ATPase6 function in vivo?

    When designing genetic models, researchers should consider:

    • Heteroplasmy effects: mtDNA mutations often exist in mixed populations

    • Tissue-specific manipulations: Using the GAL4-UAS system for targeted expression

    • Developmental timing: Employing temperature-sensitive systems for temporal control

    • Rescue experiments: Complementation with wild-type or mutant transgenes

    • Phenotypic analysis: Molecular, cellular, and physiological parameters

    For Drosophila mutations in ATP synthase components, researchers should examine parameters including developmental progression, lifespan, fertility, behavioral phenotypes, and mitochondrial morphology, as these have been shown to be affected in ATPsynC mutants .

  • How can fine-scale genetic variation analysis inform mt:ATPase6 research across Drosophila populations?

    Population genomic approaches can provide valuable insights:

    • Analyzing natural variation in mt:ATPase6 across Drosophila populations

    • Correlating variation with functional consequences and fitness

    • Investigating selection pressures on ATP synthase components

    • Comparing genetic diversity patterns between nuclear and mitochondrial-encoded subunits

    Studies in D. melanogaster have shown that fine-scale recombination rate variation is widespread throughout the genome, across all chromosomes and in different populations . While similarity is observed at broad scales, substantial differences exist at fine scales between populations. Similar approaches could be applied to study mt:ATPase6 variation and its functional consequences.

ParameterCommon MethodsTechnical ConsiderationsExpected Outcomes
Protein ExpressionInsect cell systemCodon optimization, signal sequence designFunctional protein for biochemical studies
Protein PurificationDetergent extractionTesting multiple detergents (DDM, digitonin)Stable, homogeneous protein preparation
Functional AssessmentReconstitution assaysLipid composition, protein:lipid ratioProton pumping activity measurements
Structure DeterminationCryo-EM analysisSample homogeneity, particle orientation3D structure of channel components
Mutational AnalysisSite-directed mutagenesisConservative vs. non-conservative substitutionsIdentification of critical residues
In vivo AnalysisCRISPR-mediated editingOff-target effects, homology arm designPhysiological phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.