Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 3 (mt:ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila yakuba NADH-Ubiquinone Oxidoreductase Chain 3

NADH-ubiquinone oxidoreductase chain 3 (mt:ND3) is an essential component of Complex I in the mitochondrial electron transport chain. In Drosophila yakuba, this protein is encoded by the mitochondrial genome and plays a crucial role in cellular energy metabolism. The recombinant form is typically produced by expressing the mt:ND3 gene in bacterial expression systems, most commonly Escherichia coli, with the addition of a histidine tag to facilitate purification through affinity chromatography .

The mt:ND3 protein consists of 117 amino acids, making it a relatively small yet functionally significant component of the NADH dehydrogenase complex. As a membrane-bound protein, it is characterized by multiple hydrophobic regions that anchor it within the inner mitochondrial membrane. The recombinant version preserves the primary sequence while incorporating modifications such as His-tagging to enhance laboratory utility without compromising the protein's essential structural attributes .

Role in the Electron Transport Chain

As a component of Complex I (NADH dehydrogenase), mt:ND3 participates in the first step of the mitochondrial electron transport chain. This process involves the transfer of electrons from NADH to ubiquinone (Coenzyme Q), coupled with the translocation of protons across the inner mitochondrial membrane. This proton gradient is ultimately utilized by ATP synthase to generate ATP, the primary energy currency of cells .

The mt:ND3 protein, despite its relatively small size, contributes to both the electron transfer and proton translocation functions of Complex I. Its positioning within the complex places it at a critical junction for both processes, highlighting its importance in cellular energy metabolism despite constituting only a small portion of the much larger Complex I structure .

Integration into Complex I

Within the assembled Complex I, mt:ND3 interacts with multiple other subunits to form a functional enzyme complex. The specific positioning of mt:ND3 within the membrane-embedded arm of Complex I enables it to contribute to the proton translocation pathway. These interactions are essential for maintaining the structural integrity of Complex I and ensuring efficient coupling between electron transfer and proton pumping .

The recombinant protein, when correctly folded, retains the structural features necessary for potential integration into Complex I, making it valuable for in vitro reconstitution studies and investigations of Complex I assembly and function .

Mitochondrial DNA of Drosophila yakuba

The mitochondrial genome of Drosophila yakuba encodes several genes, including mt:ND3. This genome is characterized by an exceptionally high A+T content, with the replication origin region containing 92.8% A+T nucleotides. Unlike mammalian mitochondrial DNA, the D. yakuba mtDNA lacks the sequence associated with the initiation of second-strand DNA synthesis .

Although the genes found in D. yakuba and mammalian mtDNAs are the same, there are notable differences in their arrangement and in the relative proportions of the complementary strands that serve as templates for transcription. The D. yakuba mitochondrial genome lacks introns, and there are few (0-31) intergenic nucleotides, indicating a compact genomic organization optimized for efficient gene expression .

Introgression Events and Evolutionary Dynamics

Fascinating evolutionary dynamics have been observed between D. yakuba and its sister species D. santomea. Research has identified at least two independent events of mtDNA introgression, including an early invasion of the D. yakuba mitochondrial genome that completely replaced the D. santomea native mtDNA haplotypes. A more recent, ongoing introgression event has been documented in the hybrid zone between these species .

This introgression bears the signature of Darwinian natural selection, suggesting that the D. yakuba mitochondrial genome, including the mt:ND3 gene, may confer selective advantages under certain environmental conditions. The selective haplotype has been found at low frequency in mainland African populations of D. yakuba, providing insights into the evolutionary history and selective pressures acting on mitochondrial genes .

Selection Pressures on Mitochondrial Genes

Studies comparing the efficacies of selection between mitochondrial and nuclear genes have provided valuable insights into the evolutionary forces shaping mitochondrial proteins like mt:ND3. These analyses, using D. yakuba as an outgroup for D. melanogaster, have revealed significant levels of slightly deleterious mutations in mtDNA, consistent with the predictions of nearly neutral theory for genes with smaller effective population sizes .

The comparative analysis of nonsynonymous and synonymous polymorphisms within species and fixed differences between species has enabled researchers to assess the selective pressures acting on mitochondrial genes. These studies suggest that despite having a smaller effective population size, the mitochondrial genome is subject to significant selective constraints, reflecting the functional importance of its encoded proteins, including mt:ND3 .

Expression Systems and Vectors

The recombinant D. yakuba mt:ND3 protein is typically expressed in E. coli expression systems. The protein-coding sequence is optimized for bacterial expression and cloned into an appropriate expression vector that includes a histidine tag sequence, enabling efficient expression and subsequent purification .

The recombinant protein produced in this manner consists of the full-length mt:ND3 (amino acids 1-117) fused to an N-terminal histidine tag. This approach yields significant quantities of the target protein while maintaining its structural integrity, although it lacks the post-translational modifications that might be present in the native protein from D. yakuba mitochondria .

Purification Process and Quality Control

The histidine-tagged recombinant protein is purified using affinity chromatography techniques, typically employing nickel or cobalt resins that selectively bind the histidine tag. Following binding, the protein is eluted using imidazole or through pH manipulation, resulting in a highly purified preparation of the recombinant protein .

Quality control assessments include SDS-PAGE analysis, which typically confirms a purity level greater than 90% for commercial preparations. Additional quality control measures may include mass spectrometry for protein identity confirmation and functional assays to ensure that the recombinant protein retains its expected biological activities .

Evolutionary and Comparative Studies

The recombinant protein serves as a valuable resource for evolutionary studies, enabling researchers to compare the properties of mt:ND3 across different Drosophila species and other organisms. Such comparative analyses provide insights into the evolutionary conservation and divergence of mitochondrial proteins and their functional implications .

The documented introgression of D. yakuba mitochondrial DNA into D. santomea presents an interesting case study for investigating the adaptive significance of mitochondrial genes. Recombinant mt:ND3 can be used to explore the functional differences between variants found in different populations and species, contributing to our understanding of mitochondrial evolution and adaptation .

Antibody Production and Immunological Applications

Recombinant D. yakuba mt:ND3 can be used to generate specific antibodies for various immunological applications. These antibodies enable the detection and localization of mt:ND3 in tissue samples, cell fractions, and protein complexes, facilitating studies on protein expression, subcellular localization, and complex assembly .

The availability of specific antibodies also enables immunoprecipitation experiments to isolate mt:ND3-containing complexes from cellular extracts, providing a means to study protein interactions and complex formation in native cellular environments .

Reconstitution and Buffer Conditions

Before use, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. The reconstitution process should be performed carefully to ensure complete dissolution without introducing excessive agitation that could lead to protein denaturation .

The storage buffer for reconstituted protein typically consists of a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. This buffer composition is optimized to maintain protein stability and activity during storage. For long-term storage of reconstituted protein, the addition of glycerol (50% final concentration) and aliquoting are recommended practices .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes for our preparation.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you have a preference for a particular tag type, please specify it, and we will prioritize its development.
Synonyms
mt:ND3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Drosophila yakuba (Fruit fly)
Target Names
mt:ND3
Target Protein Sequence
MFSIIIIASVILLITTVVMFLASILSKKALIDREKSSPFECGFDPKSSSRLPFSLRFFLI TIIFLIFDVEIALILPMIIILKYSNIMIWTITSIIFILILLIGLYHEWNQGMLNWSN
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Database Links

KEGG: dya:ND3

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How is the mt:ND3 gene conserved across the Drosophila yakuba species complex?

The mt:ND3 gene exhibits remarkable conservation across the Drosophila yakuba species complex, which includes D. yakuba, D. santomea, and D. teissieri. These three species share identical mitochondrial genomes despite substantial nuclear genome differentiation . This conservation is the result of mitochondrial introgression events that have occurred during the evolutionary history of these species. Research has identified at least two independent events of mitochondrial DNA introgression, including an early invasion of the D. yakuba mitochondrial genome that completely replaced D. santomea's native mtDNA haplotypes, as well as a more recent ongoing introgression event centered in the hybrid zone . This high conservation suggests that mt:ND3 plays a critical functional role that has been maintained through natural selection during these introgression events. The amino acid sequence (117 amino acids) of mt:ND3 contains highly conserved regions that are essential for proper protein function across these closely related Drosophila species .

What experimental approaches can be used to study the functional differences between D. yakuba mt:ND3 and its orthologs in other Drosophila species?

Researchers can employ several sophisticated approaches to investigate functional differences between D. yakuba mt:ND3 and its orthologs:

How does the introgression of the mitochondrial genome in the Drosophila yakuba complex affect mt:ND3 function and evolution?

The introgression of mitochondrial genomes among the Drosophila yakuba complex provides a unique natural experiment for studying mt:ND3 function and evolution:

The replacement of D. santomea's mitochondrial genome with that of D. yakuba suggests that the D. yakuba mitochondrial variants, including mt:ND3, may confer selective advantages in certain genetic backgrounds or environmental conditions. Research indicates this introgression bears signatures of Darwinian natural selection . The selective advantage may be related to mitigating the accumulation of mildly deleterious mutations associated with Muller's ratchet in D. santomea, which has a smaller effective population size than D. yakuba .

To study these effects, researchers should consider:

  • Population Genomics Approaches: Analyzing mt:ND3 haplotype frequencies across different populations and species can identify selection signatures and track introgression patterns. Particular attention should be given to the selective haplotype found at low frequency in African mainland populations of D. yakuba .

  • Functional Complementation Studies: Expressing D. yakuba mt:ND3 in systems with impaired endogenous Complex I function can assess whether it restores normal respiratory chain activity more effectively than variants from other species .

  • Hybrid Fitness Assays: Analyzing the performance of hybrid individuals with different combinations of nuclear and mitochondrial genomes can reveal functional consequences of mt:ND3 variants in different genetic backgrounds .

  • Molecular Evolution Analysis: Calculating selection coefficients and rates of evolution for mt:ND3 compared to other mitochondrial genes can identify whether this gene is under particular selective pressure during introgression events .

What methodologies are recommended for expressing and purifying recombinant D. yakuba mt:ND3 for functional studies?

Successful expression and purification of recombinant mt:ND3 requires specialized techniques due to its hydrophobic nature and mitochondrial origin:

  • Expression Systems Selection:

    • E. coli systems: For bulk production, though protein may form inclusion bodies requiring refolding .

    • Yeast expression: Offers eukaryotic post-translational modifications and membrane integration machinery.

    • Baculovirus expression: Provides higher eukaryotic processing for complex membrane proteins.

    • Mammalian cell expression: Optimal for maintaining native conformation and modifications .

  • Optimization Protocol:

    • Codon optimization: Adapt codons to the expression host to improve translation efficiency.

    • Fusion tags: Consider adding solubility tags (MBP, SUMO) or affinity tags (His, GST) to facilitate purification.

    • Expression temperature: Lower temperatures (16-25°C) often improve membrane protein folding.

    • Induction conditions: Optimize inducer concentration and duration for maximum functional protein yield.

  • Purification Strategy:

    • Membrane preparation: Isolate cellular membranes containing the recombinant protein using differential centrifugation.

    • Detergent extraction: Screen multiple detergents (DDM, LMNG, digitonin) to identify optimal solubilization conditions.

    • Chromatography: Employ affinity chromatography followed by size exclusion chromatography to achieve high purity.

    • Lipid reconstitution: Consider reconstituting the purified protein into liposomes or nanodiscs to maintain native-like environment .

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting: Confirm protein identity and purity (>90% purity is typically achievable) .

    • Mass spectrometry: Verify protein integrity and post-translational modifications.

    • Circular dichroism: Assess secondary structure to confirm proper folding.

    • Activity assays: Verify functionality through NADH oxidation assays.

How can researchers investigate the role of mt:ND3 in respiratory chain efficiency and its impact on longevity in Drosophila models?

Investigating the relationship between mt:ND3 function, respiratory chain efficiency, and longevity requires integrated approaches:

  • Genetic Manipulation Strategies:

    • Transgenic expression: Generate fly lines expressing modified versions of mt:ND3 with specific mutations or from different Drosophila species.

    • Tissue-specific expression: Use the GAL4-UAS system to express mt:ND3 variants in specific tissues to isolate effects on longevity. Neuronal expression is particularly relevant as it has been shown to increase lifespan in flies with enhanced respiratory chain activity .

    • Inducible expression: Employ temperature-sensitive or drug-inducible systems to control the timing of mt:ND3 variant expression.

  • Physiological and Metabolic Assessments:

    • Respiratory chain activity measurements: Quantify Complex I activity in isolated mitochondria from flies expressing different mt:ND3 variants.

    • ATP production: Measure ATP levels in tissues expressing modified mt:ND3 to assess energy metabolism efficiency.

    • Oxygen consumption and CO2 production: Use respirometry to evaluate whole-organism metabolic rate, which has been linked to longevity .

    • ROS production: Assess reactive oxygen species levels, as they can influence aging processes.

  • Longevity and Health Span Analyses:

    • Survival curves: Compare lifespan distributions between flies expressing different mt:ND3 variants.

    • Activity measures: Assess physical activity, fertility, and other fitness parameters to ensure increased lifespan doesn't come at the cost of compromised health .

    • Stress resistance: Test resistance to oxidative stress, heat shock, and other stressors that often correlate with longevity mechanisms.

  • Integration with Other Mitochondrial Components:

    • Complex I assembly: Analyze how mt:ND3 variants affect the assembly and stability of the complete Complex I.

    • Interaction with alternative oxidases: Consider potential synergistic or antagonistic effects with alternative respiratory chain components like NDI1 from yeast, which has been shown to enhance lifespan when expressed in fly neurons .

    • Mitochondrial dynamics: Investigate effects on mitochondrial morphology, biogenesis, and turnover processes.

How can D. yakuba mt:ND3 serve as a model for understanding mitochondrial diseases in humans?

The Drosophila yakuba mt:ND3 protein can serve as a valuable model for understanding human mitochondrial diseases through several research approaches:

  • Comparative Genetics and Function:

    • Human and Drosophila Complex I share significant structural and functional conservation, making findings in fly mt:ND3 potentially translatable to human ND3 (encoded by MT-ND3 gene).

    • Mutations in human MT-ND3 cause severe mitochondrial disorders including Leigh syndrome and MELAS. Recombinant D. yakuba mt:ND3 can be used to model these disease-causing mutations in a simpler experimental system .

    • The rapid generation time and genetic tractability of Drosophila allow for efficient screening of potential therapeutic interventions targeting mt:ND3 dysfunction.

  • Disease Modeling Methodology:

    • Generate transgenic flies expressing D. yakuba mt:ND3 variants corresponding to human disease mutations.

    • Assess phenotypic consequences including neurodegeneration, muscle function, metabolic alterations, and lifespan.

    • Utilize the natural hybrid system between D. yakuba and related species to study nuclear-mitochondrial interactions that may modulate disease phenotypes .

  • Therapeutic Strategy Development:

    • Test whether expressing alternative NADH dehydrogenases (like yeast NDI1) can bypass Complex I deficiencies caused by mt:ND3 mutations, potentially informing similar bypass strategies for human diseases .

    • Screen for small molecules that stabilize mutant mt:ND3 or enhance residual Complex I function.

    • Evaluate whether genetic or pharmacological manipulation of mitochondrial quality control pathways can mitigate consequences of mt:ND3 dysfunction.

What techniques are most effective for studying the interaction of mt:ND3 with other components of Complex I?

Investigating interactions between mt:ND3 and other Complex I components requires specialized techniques due to the complex nature of membrane protein assemblies:

  • Structural Biology Approaches:

    • Cryo-electron microscopy: Currently the most effective method for resolving the structure of entire respiratory complexes, allowing visualization of mt:ND3 interactions within the native complex.

    • Crosslinking mass spectrometry: Identifies interaction sites by chemically linking nearby protein regions and identifying these linkages through mass spectrometry.

    • Protein footprinting: Determines exposed and protected regions of mt:ND3 in isolation versus within the assembled complex.

  • Biochemical Interaction Analyses:

    • Co-immunoprecipitation: Using antibodies against mt:ND3 or epitope-tagged versions to pull down interaction partners.

    • Blue native PAGE: Separates intact respiratory complexes to assess the incorporation of mt:ND3 variants into Complex I.

    • Proximity labeling: Techniques like BioID or APEX2 can identify proteins in close proximity to mt:ND3 in living cells.

    • Surface plasmon resonance or microscale thermophoresis: Measures direct binding between purified mt:ND3 and other complex components.

  • Genetic Interaction Studies:

    • Suppressor/enhancer screens: Identify mutations in other genes that modify phenotypes caused by mt:ND3 variants.

    • Synthetic lethality approaches: Test for genetic combinations that are viable individually but lethal when combined.

    • Allelic series analysis: Compare the effects of different mt:ND3 mutations on interactions with other Complex I components.

  • Computational Approaches:

    • Molecular dynamics simulations: Model the dynamic interactions between mt:ND3 and neighboring subunits.

    • Evolutionary coupling analysis: Identify co-evolving residues between mt:ND3 and other subunits that likely represent functional interaction sites.

    • Protein-protein docking: Predict interaction interfaces between mt:ND3 and other Complex I components.

What are the key challenges in working with recombinant mt:ND3 and how can they be addressed?

Working with recombinant mt:ND3 presents several technical challenges that researchers should anticipate:

  • Hydrophobicity and Membrane Integration:

    • Challenge: As a mitochondrial membrane protein, mt:ND3 is highly hydrophobic and difficult to express in soluble form.

    • Solution: Use specialized detergents for extraction (DDM, LMNG); consider fusion with solubility-enhancing tags; explore membrane mimetics like nanodiscs or amphipols for maintaining native conformation .

  • Proper Folding and Assembly:

    • Challenge: Ensuring correct folding when expressed outside the context of the mitochondrial membrane and other Complex I components.

    • Solution: Express in eukaryotic systems with appropriate chaperones; optimize expression conditions (temperature, inducer concentration); consider co-expression with interacting partners .

  • Post-translational Modifications:

    • Challenge: Recombinant systems may not reproduce native post-translational modifications.

    • Solution: Select expression systems that can perform necessary modifications; verify modification status by mass spectrometry; assess functional consequences of modification differences .

  • Functional Assessment:

    • Challenge: Isolated mt:ND3 may not exhibit measurable activity outside the context of assembled Complex I.

    • Solution: Develop partial assembly systems; use reconstitution approaches; employ sensitive activity assays; consider structural or binding assays as proxies for function .

  • Stability Issues:

    • Challenge: mt:ND3 may be unstable when purified, leading to aggregation or denaturation.

    • Solution: Optimize buffer conditions (pH, ionic strength, glycerol content); store in 50% glycerol at -20°C or -80°C; avoid repeated freeze-thaw cycles; prepare working aliquots for storage at 4°C for up to one week .

How can evolutionary insights from the D. yakuba species complex inform functional studies of mt:ND3?

The unique evolutionary history of the Drosophila yakuba species complex provides valuable context for functional studies of mt:ND3:

  • Natural Variation Analysis:

    • The introgression of D. yakuba mitochondrial DNA into D. santomea represents a natural experiment revealing which mt:ND3 variants have been favored by selection .

    • By comparing the functional properties of mt:ND3 variants that have successfully introgressed versus those that haven't, researchers can identify functionally important features.

    • The recent introgression event bearing signatures of Darwinian selection offers insights into which specific changes might confer adaptive advantages .

  • Nuclear-Mitochondrial Co-adaptation:

    • The yakuba complex provides a model for studying how mt:ND3 co-evolves with nuclear-encoded Complex I components.

    • Hybrids between species (which naturally form at ~3% frequency) can reveal incompatibilities or synergies between different nuclear backgrounds and mt:ND3 variants .

    • Functional studies should consider testing mt:ND3 variants in both native and non-native nuclear backgrounds to understand context-dependent effects.

  • Selection Pressure Analysis:

    • The hypothesis that D. santomea's smaller effective population size led to accumulation of deleterious mutations (Muller's ratchet) suggests examining whether introgressed D. yakuba mt:ND3 variants show improved biochemical properties .

    • Functional assays comparing enzymatic efficiency, stability, and assembly properties of mt:ND3 variants from different species can test this hypothesis.

    • Measuring selection coefficients for specific mt:ND3 variants can help identify which properties are most important for fitness.

  • Experimental Design Considerations:

    • Include mt:ND3 variants from all three species (D. yakuba, D. santomea, D. teissieri) in comparative studies.

    • Consider the temporal dimension by comparing ancestral (pre-introgression) variants with current variants.

    • Use the natural hybrid zone as a source of individuals with different combinations of nuclear backgrounds and mt:ND3 variants for functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.