Recombinant Drosophila yakuba Serine protease HTRA2, mitochondrial (HtrA2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HtrA2; GE26447; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
75-422
Protein Length
Full Length of Mature Protein
Species
Drosophila yakuba (Fruit fly)
Target Names
Target Protein Sequence
AAVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ
PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLR
IQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY
LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSA
YKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSHLTHGVLVWKVIVGSPAHSGGLQPG
DIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPEDP
Uniprot No.
Target Background
Function
Recombinant Drosophila yakuba Serine protease HTRA2, mitochondrial (HtrA2) is a serine protease exhibiting proteolytic activity against the non-specific substrate β-casein. It promotes or induces cell death through two potential mechanisms: (1) direct binding and inhibition of BIRC proteins (Inhibitor of Apoptosis Proteins, IAPs), resulting in increased caspase activity; or (2) a BIRC-independent, caspase-independent mechanism reliant on its serine protease activity. This protease can antagonize the anti-apoptotic activity of IAPs by directly inducing their degradation.
Database Links
KEGG: dya:Dyak_GE26447
STRING: 7245.FBpp0271457
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
