Recombinant Drosophila yakuba Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Functional Domains and Mechanism

Spastin’s activity is driven by two conserved domains:

  • AAA ATPase domain: Catalyzes ATP hydrolysis to sever microtubules .

  • Microtubule-Interacting and Trafficking (MIT) domain: Binds microtubules and facilitates hexamerization .

In Drosophila, Spastin exhibits dual functionality:

  1. Microtubule Severing: ATP-dependent cleavage of microtubules into shorter fragments .

  2. Microtubule Dynamics Regulation: ATP-independent stabilization of shrinking microtubule ends, increasing rescue frequency and promoting regrowth .

Key Mechanistic Insights:

  • Hexameric Spastin rings target microtubule lattices, inducing breaks via conformational changes during ATP hydrolysis .

  • Mutations in the AAA domain (e.g., K388R) abolish ATPase activity, leading to dominant-negative effects or haploinsufficiency phenotypes .

Research Applications

Recombinant Drosophila yakuba Spastin is used to investigate:

Microtubule Network Remodeling

  • Overexpression in neuronal or muscle tissues erases microtubule networks, mimicking gain-of-function phenotypes .

  • Loss-of-function mutants show reduced microtubule bundles in synaptic terminals, impairing neurotransmission .

Disease Modeling

  • Drosophila Spastin mutants replicate axonopathy seen in hereditary spastic paraplegia (HSP), including synaptic undergrowth and locomotion deficits .

  • Human Spastin rescues Drosophila null mutants, confirming functional conservation .

Lipid Droplet Dynamics

  • Spastin-M1 isoform targets lipid droplets (LDs) via a hydrophobic motif (residues 57–86), modulating LD size and triacylglycerol storage .

Comparative Analysis with Orthologs

FeatureDrosophila yakuba SpastinDrosophila melanogaster Spastin
AAA Domain Conservation98% identity 100% identity
Severing ActivityATP-dependent ATP-dependent
Expression SystemsE. coli, yeast, mammalian cells Neuronal, muscle tissues

Technical Considerations

  • Partial Protein Limitation: The recombinant product lacks full-length sequence , potentially affecting studies requiring intact MIT or regulatory domains.

  • Purity and Stability: ≥85% purity ensures reproducibility in biochemical assays, but storage conditions (lyophilized at -80°C) are critical to prevent aggregation .

Future Directions

  • Structural Studies: Cryo-EM of Drosophila yakuba Spastin hexamers bound to microtubules.

  • Therapeutic Screening: High-throughput assays to identify compounds modulating Spastin’s severing activity for HSP treatment.

Recombinant Drosophila yakuba Spastin serves as a vital tool for dissecting microtubule-related mechanisms in neurodegeneration, with cross-species relevance to human pathologies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
spas; GE23439; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Drosophila yakuba (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSSTKSPIKSSSATGSSGGGVGGRQSTHRSSSASNVAAVVAGGSSA AGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHTYGGYSSSVHKQNLYVVSF PIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPS ELNRDSDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYI SKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSM ARDRLHFLALREQDLQMQRLSLKEKQNEQAPSKPQRTREPMLAGMTNEPMKLRVRSSGYG PKATTGAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPP AVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKV EWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATEC SATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASR RLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLL NRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMR AITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Plays a role in axon regeneration by regulating microtubule severing.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is Spastin and what is its primary function in Drosophila?

Spastin in Drosophila functions as a dual-function enzyme that regulates microtubule dynamics. It combines ATP-dependent microtubule severing with ATP-independent modulation of dynamic instability . The protein contains a highly conserved carboxyl-terminal 'AAA' ATPase catalytic domain responsible for its severing activity, as well as a microtubule-interacting and trafficking (MIT) domain that facilitates binding to microtubule polymers . These domains enable spastin monomers to assemble into hexameric, ring-shaped ATPases that sever microtubules along their lengths, a process distinct from the dynamic instability mechanism that occurs only at microtubule ends .

Beyond microtubule severing, recent research demonstrates that Drosophila spastin also plays a role in lipid metabolism, with the ability to bind to lipid droplets and affect their size, number, and distribution in various tissues .

How does Drosophila yakuba Spastin compare structurally to human Spastin?

There is remarkable functional conservation between Drosophila and human Spastin. Studies have demonstrated that exogenous expression of either wild-type Drosophila or human spastin rescues behavioral and cellular defects in spastin null flies with equivalent efficacy . This conservation is reflected in the protein structure, particularly in the AAA catalytic domain, which is highly conserved between species .

The amino acid sequence of Drosophila yakuba Spastin includes multiple serine-rich regions and a glycine-rich region near the N-terminus, followed by the functional domains that are conserved with human Spastin . Mutations that affect ATP binding and hydrolysis in the catalytic domain, such as the K388R mutation in human Spastin (analogous to R388 in some Drosophila studies), lead to similar disruption of function across species .

What experimental methods can verify recombinant Drosophila yakuba Spastin activity?

To verify the activity of recombinant Drosophila yakuba Spastin, researchers should employ a combination of techniques:

  • Microtubule severing assays: In vitro assays using fluorescently labeled microtubules and purified recombinant Spastin can directly measure severing activity. Active spastin will cause fragmentation of microtubules observable through fluorescence microscopy .

  • Dynamic instability measurements: Researchers can measure changes in microtubule growth and shrinkage rates in the presence of recombinant Spastin. As demonstrated experimentally, active Spastin decreases the shrinkage rate approximately 2-fold and increases rescue frequency more than 10-fold .

  • ATP hydrolysis assays: Since the severing function is ATP-dependent, measuring ATP hydrolysis rates can confirm enzymatic activity. Comparison of activity with and without microtubules present can distinguish between basal and substrate-stimulated ATP hydrolysis .

The hallmark of active Spastin is its dual effect: (1) ATP-dependent severing of microtubules and (2) ATP-independent modulation of dynamics, which can be observed separately by conducting assays with and without ATP .

How can researchers distinguish between Spastin's ATP-dependent and ATP-independent functions?

Distinguishing between Spastin's dual functions requires carefully designed experimental approaches:

Experimental Protocol for Differential Function Analysis:

  • ATP-independent modulation of dynamics:

    • Conduct dynamic microtubule assays using interference reflection microscopy (IRM)

    • Include conditions with recombinant Spastin but either no ATP or non-hydrolyzable ATP analogs (AMP-PNP)

    • Measure key parameters: shrinkage rate, catastrophe frequency, and rescue frequency

    • Under these conditions, no severing will be observed, but changes in dynamics will persist

  • ATP-dependent severing activity:

    • Use the same experimental setup with ATP present

    • Document severing events through time-lapse imaging

    • Quantify the number of severing events per microtubule length per time

    • Compare microtubule density before and after Spastin treatment

Evidence from experimentation shows that Spastin decreases shrinkage rates and increases rescue frequency even without ATP, while severing activity strictly requires ATP hydrolysis . This experimental separation allows researchers to isolate these distinct functions and study their individual contributions to microtubule regulation.

What are the critical parameters to monitor when studying Spastin's effects on microtubule networks?

When investigating Spastin's impact on microtubule networks, researchers should monitor these key parameters:

ParameterMeasurement MethodExpected Effect with Active SpastinExperimental Context
Microtubule shrinkage rateTime-lapse imagingDecrease by ~50%In vitro and in vivo assays
Rescue frequencyEvent counting in kymographsIncrease >10-foldIn vitro dynamics assays
Catastrophe frequencyEvent counting in kymographsDecrease by ~50%In vitro dynamics assays
Microtubule length distributionFluorescence microscopyShift to shorter, more uniform lengthsIn vitro severing assays
Microtubule mass/densityFluorescence intensityIncrease over timeBulk assays with tubulin
Microtubule bundlingFluorescence microscopyFormation of bundlesIn vitro and in vivo

For comprehensive analysis, researchers should combine these measurements to differentiate between severing effects and dynamic instability modulation. The experimental observation that Spastin leads to an exponential increase in microtubule mass despite its severing activity explains the seemingly paradoxical finding that inhibiting severases in vivo decreases rather than increases microtubule number .

How can genetic models be designed to study Spastin mutations relevant to human disease?

To create genetically representative models of Spastin-related diseases such as autosomal dominant hereditary spastic paraplegia (AD-HSP), researchers can implement the following approach, which has been successfully demonstrated in Drosophila:

  • Generation of null background: First establish a spastin null fly line (such as the spastin^5.75 allele) to eliminate endogenous protein expression .

  • Transgene construction: Design transgenic constructs expressing:

    • Wild-type human Spastin (H-WT)

    • Disease-relevant mutant variants (e.g., H-R388, analogous to K388R human mutation)

    • Compound heterozygous combinations (e.g., H-L44,H-R388)

  • Controlled expression systems: Utilize tissue-specific or inducible expression systems such as:

    • Pan-neuronal drivers (elav-GAL4)

    • Muscle-specific drivers (24B-GAL4)

    • Inducible systems (elav-GS-GAL4 with RU486 induction)

  • Phenotypic analysis: Assess key parameters including:

    • Eclosion rates (typically reduced to <6% in nulls, rescued to ~50% with wild-type expression)

    • Behavioral assays (locomotor activity)

    • Synaptic morphology

    • Microtubule distribution using immunofluorescence

When expressing disease-relevant mutations, titration of expression levels is critical as overexpression of even wild-type Spastin can be deleterious, suggesting that proper spatiotemporal expression patterns are essential for rescue .

How does Spastin expression affect lipid metabolism and lipid droplet biology?

Recent research has revealed an unexpected role for Spastin in lipid metabolism. The effects of Spastin on lipid droplets (LDs) are tissue-specific and display different phenotypes depending on expression patterns:

  • In fat bodies:

    • Ubiquitous overexpression of Drosophila Spastin (Dspastin) leads to fewer but larger LDs

    • Increased triacylglycerol levels are observed

    • Expression of a dominant-negative variant decreases LD number and reduces triacylglycerol levels

  • In skeletal muscles and nerves:

    • Tissue-specific overexpression increases LD number, contrasting with effects in fat bodies

    • Downregulation of Dspastin decreases LD number in these tissues

  • Mechanistic insights:

    • The spastin-M1 isoform (containing a hydrophobic motif comprised of amino acids 57-86) can sort from the endoplasmic reticulum to pre- and mature lipid droplets

    • Mutation of arginine 65 to glycine abolishes LD targeting

    • Expression of a microtubule-binding deficient mutant causes clustering of LDs, indicating that the microtubule-severing function may coordinate with lipid metabolism functions

These findings suggest that Spastin's role extends beyond microtubule regulation to include lipid homeostasis, with the microtubule cytoskeleton potentially serving as a coordinating system between these functions. Research methodologies should incorporate lipid staining techniques and biochemical lipid analysis when studying Spastin's cellular effects .

What experimental approaches resolve contradictory findings about Spastin's effects in different tissues?

To resolve the apparently contradictory findings regarding tissue-specific effects of Spastin, researchers should implement multi-faceted experimental approaches:

  • Tissue-specific expression systems:

    • Use the GAL4-UAS system with tissue-specific promoters to express Spastin selectively

    • Compare effects between neuronal (elav-GAL4), muscle (24B-GAL4), and fat body (ppl-GAL4) drivers

    • Employ inducible expression systems to control timing and level of expression

  • Isoform-specific analysis:

    • Generate constructs expressing specifically the M1 or M87 isoforms of Spastin

    • Perform domain mapping using truncation mutants to identify tissue-specific functional regions

    • Use isoform-specific antibodies for immunolocalization studies

  • Quantitative phenotypic analysis:

    • For lipid droplets: measure number, size, and distribution using confocal microscopy

    • For microtubules: assess bundling, fragmentation, and density

    • For cellular function: examine organelle distribution, transport, and cell morphology

  • Biochemical analysis:

    • Measure triacylglycerol levels in different tissues under various Spastin expression conditions

    • Perform co-immunoprecipitation to identify tissue-specific binding partners

    • Use lipid binding assays to characterize direct interactions with lipid membranes

Research shows that contradictory phenotypes (such as increased versus decreased lipid droplet numbers) may reflect fundamental differences in lipid metabolism between tissues, with neurons and muscles potentially responding differently to cytoskeletal changes than fat storage tissues .

What mathematical models explain Spastin's seemingly paradoxical effects on microtubule mass?

The paradoxical observation that a microtubule-severing protein increases rather than decreases microtubule mass can be explained through mathematical modeling:

  • Dynamic instability model with severing:

    • Build upon the Dogterom and Leibler model of microtubule dynamics

    • Incorporate severing events as stochastic processes

    • Include Spastin's effects on dynamic parameters (decreased shrinkage rate, increased rescue frequency)

  • Key mathematical findings:

    • Without Spastin's effect on dynamics, severing alone would reduce microtubule mass

    • When Spastin switches microtubules to a state where net tubulin flux onto each polymer is positive, exponential increase in mass occurs

    • The model predicts a narrower length distribution with a peak, as opposed to the exponential distribution seen without severing

  • Experimental validation:

    • The spin-down assay confirmed the model's prediction of increased microtubule mass in bulk

    • Length distributions shifted from exponential (mean 5.5 μm, SD 4.4 μm) to peaked distributions (mean 4.0 μm, SD 2.1 μm) as predicted

This mathematical framework demonstrates that Spastin's dual functionality is essential for its biological role - the ATP-independent promotion of rescue and reduction of shrinkage allows severed fragments to regrow rather than disappear, leading to amplification of microtubule number and mass over time .

How can researchers distinguish between dominant-negative and haploinsufficiency disease mechanisms?

Distinguishing between dominant-negative and haploinsufficiency mechanisms in Spastin-related disorders requires carefully designed experimental approaches:

  • Genetic models for mechanism testing:

    • Co-expression systems: Express wild-type and mutant Spastin in defined ratios in the null background

    • Dosage sensitivity analysis: Compare phenotypes with varying levels of wild-type expression

    • Compound heterozygous models: Create flies expressing different combinations of mutations on separate alleles

  • Biochemical approaches:

    • Oligomerization assays: Test whether mutant proteins can incorporate into hexameric complexes with wild-type subunits

    • Competitive binding assays: Determine if mutant proteins compete with wild-type for microtubule binding sites

    • Protein expression analysis: Assess whether truncated proteins are produced from early termination codon mutations

  • Evidence-based assessment:

    • Research findings support both mechanisms:

      • Dominant-negative evidence: The R388 mutant Spastin associates with bundled microtubules in a filamentous pattern but fails to sever them, potentially competing with wild-type protein for binding sites

      • Haploinsufficiency evidence: The absence of truncated protein variants in patients with early termination codon mutations suggests haploinsufficiency as a disease mechanism

Experimental evidence suggests that different mutations may operate through different mechanisms, and comprehensive analysis requires testing multiple mutation types within the same experimental system .

What are common technical challenges when working with recombinant Spastin in experimental systems?

Researchers working with recombinant Drosophila yakuba Spastin should be aware of several technical challenges and their solutions:

  • Protein expression and purification issues:

    • Challenge: Aggregation during expression due to high hydrophobicity

    • Solution: Optimize expression temperature (typically 16-18°C), consider fusion tags like SUMO or MBP, use detergents during purification

  • Activity variation between preparations:

    • Challenge: Inconsistent severing activity between protein batches

    • Solution: Standardize activity using quantitative microtubule severing assays, store in optimized buffer with 50% glycerol at -20°C, avoid repeated freeze-thaw cycles

  • Experimental control considerations:

    • Challenge: Distinguishing Spastin effects from background microtubule dynamics

    • Solution: Include non-hydrolyzable ATP analogs (AMP-PNP) as controls, use catalytically inactive mutants (e.g., K388R) as negative controls

  • Concentration-dependent effects:

    • Challenge: Different phenotypes at varying concentrations

    • Solution: Perform careful titration experiments; excessive overexpression of even wild-type Spastin can be deleterious, while insufficient levels may not show effects

  • Imaging and quantification challenges:

    • Challenge: Capturing rapid severing events and dynamic changes

    • Solution: Use high-speed imaging, interference reflection microscopy (IRM), and automated tracking software for optimal visualization and quantification of dynamic events

Adherence to optimal storage conditions (Tris-based buffer with 50% glycerol at -20°C or -80°C) and avoiding repeated freeze-thaw cycles are critical for maintaining protein activity between experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.