Recombinant Drosophila yakuba Vacuolar ATPase assembly integral membrane protein VMA21 (GE19686)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Drosophila yakuba Vacuolar ATPase assembly integral membrane protein VMA21 (GE19686) is a bioengineered protein produced through recombinant DNA technology. It is derived from the fruit fly species Drosophila yakuba and corresponds to the gene identifier GE19686 (UniProt: B4PET6). This protein is critical for the assembly of the vacuolar ATPase (V-ATPase), a proton pump essential for lysosomal acidification and cellular homeostasis .

Role in V-ATPase Assembly

VMA21 is an ER-resident chaperone essential for the proper assembly of the V₀ domain of the V-ATPase, particularly the proton-translocating subunits (e.g., ATP6V0C, ATP6V0D1) . Mutations in VMA21 disrupt V₀ assembly, leading to:

  • Reduced expression of V₀ subunits (e.g., ATP6V0C/D1) .

  • Impaired interaction with assembly factors (e.g., ATP6AP2) .

  • Defective lysosomal acidification, resulting in autophagy dysfunction and cellular vacuolation .

Clinical Relevance

While GE19686 itself is not directly linked to human diseases, studies on VMA21 mutations highlight its role in:

  • Congenital Disorders of Glycosylation (CDG) and X-linked Myopathy with Excessive Autophagy (XMEA) .

  • Lysosomal storage diseases due to impaired autophagy-lysosomal pathways .

Applications in Research

ApplicationDetailsSource
Protein Interaction StudiesCo-immunoprecipitation (Co-IP) with V₀ subunits or ATP6AP2
Functional AssaysMeasuring V-ATPase activity via pH-sensitive dyes (e.g., LysoSensor)
Western BlotDetection of VMA21 expression levels in cellular lysates
Yeast Model StudiesRescue assays to assess proton pump function under stress conditions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
GE19686; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Drosophila yakuba (Fruit fly)
Target Names
GE19686
Target Protein Sequence
MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHVALGLYIYRAYFGAPGSKASKTD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. This complex plays a crucial role in maintaining cellular pH homeostasis by pumping protons across membranes.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the primary function of VMA21 in Drosophila yakuba?

VMA21 serves as an essential assembly factor for the V-ATPase complex, specifically facilitating assembly of the V₀ domain in the endoplasmic reticulum (ER). It initially interacts with the c' subunit, promoting the assembly of proteolipid subunits into a ring structure. Once the V₀ domain is fully assembled, VMA21 escorts it to the cis-Golgi, where it binds with the V₁ sector to form the functional V-ATPase. This assembly mechanism is critical for the acidification of intracellular compartments, particularly lysosomes .

How is VMA21 structurally conserved across species?

While the search results focus on human and yeast VMA21, evolutionary conservation suggests D. yakuba VMA21 would share key structural features. Human VMA21 and yeast Vma21p share approximately 30% similarity, though human VMA21 lacks the C-terminal dilysine motif necessary for ER retrieval present in yeast . The D. yakuba protein likely contains two transmembrane domains with a functionally important luminal loop region, similar to the human protein where mutations in this region (such as p.Asn63Gly) can cause dysfunction .

What protein interactions are critical for VMA21 function?

Key protein interactions for VMA21 include:

  • Direct binding to the c' subunit of the V₀ domain to initiate assembly

  • Interaction with ATP6AP2 (another assembly factor)

  • Association with the ATP6V0C subunit (a component of the V₀ domain)

  • Possible interactions with other ER assembly factors (TMEM199, CCDC115) that coordinate V-ATPase assembly

These interactions are essential for proper V-ATPase assembly, and mutations that impair these interactions can reduce assembly efficiency even when protein expression levels remain normal .

What methods can be used to assess VMA21 expression levels in transgenic Drosophila models?

For quantitative assessment of VMA21 expression:

  • mRNA analysis: Real-time quantitative PCR (qPCR) can measure VMA21 transcript levels, allowing detection of potential mRNA instability caused by mutations. This approach helped distinguish between CDG and XMEA variants in human studies .

  • Protein expression analysis: Western blotting using anti-VMA21 antibodies can determine protein levels, with normalization to housekeeping proteins. This technique was critical in demonstrating reduced protein expression in patient fibroblasts carrying VMA21 mutations .

  • Fluorescent tagging: For localization studies, GFP-tagged VMA21 constructs can visualize protein distribution in Drosophila tissues when expressed under tissue-specific promoters.

How can V-ATPase assembly be assessed in Drosophila systems expressing recombinant VMA21?

V-ATPase assembly can be evaluated through:

  • Western blot analysis of V₀ subunits: Measuring levels of V₀ subunits like ATP6V0D1 and ATP6V0C through immunoblotting can reveal assembly defects. In human studies, VMA21 mutations resulted in reduced V₀ subunit expression while V₁ subunits remained unaffected .

  • Co-immunoprecipitation (Co-IP): Using tagged VMA21 to pull down V-ATPase components can assess interaction efficiency. Studies with human VMA21 variants showed reduced interactions with ATP6AP2 and ATP6V0C even when the mutant proteins were expressed at normal levels .

  • Blue Native PAGE: This technique can separate intact V-ATPase complexes to evaluate assembly efficiency in Drosophila tissues expressing wild-type or mutant VMA21.

What are validated methods to assess V-ATPase function in Drosophila systems with altered VMA21 expression?

Several methods can assess the functional impact of VMA21 alterations:

  • LysoSensor/LysoTracker assays: These fluorescent dyes specifically label acidic cellular compartments. LysoSensor fluorescence intensity inversely correlates with pH, while LysoTracker identifies acidic organelles. In VMA21-deficient human cells, both markers showed reduced number and intensity of positive punctae .

  • Cathepsin activity assays: Lysosomal proteases like cathepsin B (CTSB) require acidic pH for optimal activity. Fluorescent substrates (e.g., cresyl violet-based) can measure CTSB activity in live cells, providing functional readouts of lysosomal acidification. VMA21 deficiency in human cells resulted in reduced CTSB activity comparable to treatment with the V-ATPase inhibitor bafilomycin A1 .

  • Lysosomal morphology: Immunofluorescence analysis of lysosomal markers (like LAMP1) can reveal changes in lysosomal size and distribution. VMA21-deficient human cells displayed increased LAMP1 intensity and enlarged LAMP1-positive vesicles, indicating impaired lysosomal turnover .

How can yeast complementation studies be adapted to assess Drosophila VMA21 function?

The yeast growth assay in elevated zinc conditions provides a robust system for functional assessment:

  • Experimental design:

    • Transform VMA21-deficient yeast with D. yakuba VMA21 variants

    • Culture in media containing elevated zinc concentrations (nonpermissive conditions)

    • Monitor growth over time compared to controls

  • Expected results:

    • Functional VMA21 will restore growth under nonpermissive conditions

    • Dysfunctional variants will show impaired growth rescue

    • The degree of growth impairment correlates with functional deficiency

  • Adaptation considerations:

    • Codon optimization for yeast expression

    • Addition of appropriate yeast promoters and terminators

    • Possible addition of the yeast C-terminal dilysine motif to improve function

This approach has successfully demonstrated functional deficits in human VMA21 variants and can be adapted for D. yakuba VMA21 .

How can recombinant D. yakuba VMA21 be used to study autophagy mechanisms in Drosophila models?

Recombinant VMA21 offers powerful tools for dissecting autophagy pathways:

  • Lipophagy analysis: VMA21 deficiency in humans impairs lipophagy, resulting in lipid droplet accumulation within autolysosomes. By modulating VMA21 expression in Drosophila, researchers can study lipophagy mechanisms through:

    • Nile Red or BODIPY staining to visualize lipid droplets

    • Electron microscopy to detect lipid-containing autolysosomes

    • Co-localization of lipid markers with autophagy proteins

  • Tissue-specific autophagy studies: Using the GAL4-UAS system to express wild-type or mutant VMA21 in specific tissues can reveal tissue-dependent autophagy regulation. This approach may help explain why human VMA21 mutations cause tissue-specific phenotypes despite ubiquitous expression .

  • Autophagic flux measurement: Tandem-tagged LC3 (mRFP-GFP-LC3) constructs can monitor autophagic flux in Drosophila tissues with altered VMA21 expression, revealing specific steps of autophagy that are impaired.

What experimental approaches can assess the impact of VMA21 on endoplasmic reticulum stress responses?

VMA21 deficiency triggers ER stress in human cells, suggesting several approaches to study this connection:

  • BiP/GRP78 induction: Measuring levels of this ER chaperone by immunoblotting or qPCR can indicate ER stress activation. Human VMA21 deficiency was associated with increased ER stress markers .

  • PERK phosphorylation analysis: Western blotting for phosphorylated PERK can quantify activation of this ER stress sensor. Different human VMA21 variants showed variable effects on PERK phosphorylation, with CDG variants causing stronger activation than XMEA variants .

  • XBP1 splicing assay: RT-PCR analysis of XBP1 splicing provides a sensitive measure of IRE1 activation during ER stress.

  • ER stress response reporters: Transgenic flies carrying UPR element reporters can visualize ER stress activation in tissues with altered VMA21 expression.

How can D. yakuba VMA21 be used in evolutionary studies of V-ATPase assembly?

Evolutionary studies can leverage D. yakuba VMA21 in several ways:

  • Cross-species complementation: Testing whether D. yakuba VMA21 can rescue defects in yeast, human, or other Drosophila species can reveal functionally conserved domains. This approach has been used with human and yeast VMA21, showing partial functional conservation despite only 30% sequence similarity .

  • Domain swapping experiments: Creating chimeric proteins with domains from different species can identify regions critical for species-specific functions or interactions.

  • Comparative mutation analysis: Introducing equivalent mutations to those found in human disease (like p.Asn63Gly or p.Arg18Gly) into D. yakuba VMA21 can determine if pathogenic mechanisms are conserved across species .

What experimental design would best address tissue-specific effects of VMA21 dysfunction?

To investigate tissue specificity, researchers could implement:

  • Tissue-specific knockdown/expression: Using GAL4 drivers to modulate VMA21 expression in specific tissues (muscle, liver/fat body, neurons) can reveal differential sensitivities.

  • Transcriptomic analysis: RNA-seq comparing different tissues with altered VMA21 expression may identify tissue-specific compensatory mechanisms or vulnerability factors.

  • Metabolic profiling: Lipidomics and metabolomics of different tissues with VMA21 dysfunction can reveal tissue-specific metabolic adaptations.

  • Expression profiling of assembly factors: qPCR or proteomic analysis of V-ATPase assembly factors across tissues might explain differential sensitivity, as suggested by studies of human VMA21 deficiency showing tissue-specific clinical manifestations .

What strategies can overcome expression difficulties with recombinant D. yakuba VMA21?

As a membrane protein, VMA21 may present expression challenges:

  • Codon optimization: Adapting the coding sequence to the expression system's codon bias can improve translation efficiency.

  • Fusion tags: Adding solubility-enhancing tags (MBP, SUMO) or epitope tags (HA, Myc) can improve expression and detection. Studies with human VMA21 successfully used Myc-tagged constructs for interaction studies .

  • Expression conditions optimization:

    • Reduced temperature during induction

    • Specialized host strains for membrane proteins

    • Use of mild detergents for extraction and purification

  • Alternative expression systems: If bacterial expression fails, consider Drosophila S2 cells, which may provide a more native environment for proper folding and modification.

How can researchers distinguish direct versus indirect effects of VMA21 dysfunction?

Distinguishing primary from secondary effects requires careful experimental design:

  • Acute vs. chronic manipulation: Comparing acute (e.g., temperature-sensitive alleles) versus chronic (stable transgenic lines) VMA21 dysfunction can separate immediate from adaptive effects.

  • Rescue experiments: Reintroducing wild-type VMA21 after knockdown can identify reversible phenotypes (likely direct effects) versus irreversible changes (likely secondary adaptations).

  • Parallel inhibitor studies: Comparing VMA21 manipulation to direct V-ATPase inhibition (e.g., with bafilomycin A1) can distinguish assembly-specific versus general acidification defects. Human studies showed similar CTSB activity reduction in VMA21-deficient cells and bafilomycin-treated controls .

  • Temporal analysis: Time-course studies following VMA21 manipulation can establish the sequence of cellular events, helping determine causality.

How can D. yakuba VMA21 studies inform human disease mechanisms?

D. yakuba VMA21 research can provide insights into human pathologies:

  • Modeling disease mutations: Introducing equivalent mutations to those found in human VMA21-related diseases (XMEA, VMA21-CDG) into D. yakuba VMA21 can establish Drosophila disease models. Human studies showed that different VMA21 mutations had varying effects on mRNA stability, protein expression, and V-ATPase assembly .

  • Metabolic disease connections: As human VMA21 deficiency leads to steatohepatitis and hypercholesterolemia, Drosophila models may reveal conserved links between V-ATPase function and lipid metabolism. Human VMA21 deficiency triggered ER stress and activated SREBP-mediated cholesterol synthesis pathways .

  • Drug screening platform: Drosophila models expressing mutant VMA21 could be used to screen for compounds that improve V-ATPase assembly or function, potentially identifying therapeutic candidates for human VMA21-related diseases.

What methodological approaches best assess glycosylation effects of VMA21 dysfunction?

Human VMA21 deficiency causes abnormal protein glycosylation, suggesting several approaches:

  • Carbohydrate-deficient transferrin (CDT) analysis: Similar to the analysis performed in human patients, this can detect N-glycosylation abnormalities in Drosophila hemolymph proteins .

  • Mass spectrometry: Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) can characterize N-glycan and O-glycan profiles, as done in human VMA21-CDG patient studies that revealed truncated glycans lacking galactose and sialic acid .

  • Lectin blotting: Different lectins can detect specific glycan structures, allowing rapid screening for glycosylation abnormalities in Drosophila tissues with VMA21 dysfunction.

  • Reporter glycoproteins: Expressing well-characterized glycoproteins in Drosophila can provide sensitive readouts of glycosylation defects resulting from VMA21 dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.