Recombinant Dugong dugon Alpha-2B adrenergic receptor (ADRA2B)

What is the Alpha-2B adrenergic receptor and what is its functional significance?

The Alpha-2B adrenergic receptor (ADRA2B) is a G-protein coupled receptor that plays a crucial role in the noradrenergic neurotransmission system. It functions as an autoreceptor that inhibits norepinephrine (NE) release when activated . In humans, ADRA2B has been significantly linked to emotional memory processing, with genetic variations in this receptor affecting how emotional events are encoded and retrieved in memory . Specifically, the receptor is involved in the amygdala-dependent enhancement of memory for emotionally arousing events through its modulation of noradrenergic transmission .

How does the Dugong dugon ADRA2B differ from human ADRA2B?

The Dugong dugon (sea cow) ADRA2B shares structural features with other mammalian alpha-2 adrenergic receptors but exhibits species-specific amino acid sequences. Based on available protein data, the full-length Dugong ADRA2B consists of 390 amino acids . While the functional properties have not been extensively characterized in comparison to human ADRA2B, the conservation of key structural domains suggests similar mechanisms of action in noradrenergic signaling. The amino acid sequence of the Dugong ADRA2B includes characteristic seven-transmembrane domains typical of G-protein coupled receptors, as evidenced by the full sequence provided in the product specifications .

What is known about the genetic variations of ADRA2B and their functional consequences?

A well-studied variation in human ADRA2B is a functional deletion variant that affects emotional memory processing. This deletion involves three glutamic acid residues and results in altered receptor function . In vitro studies show that this deletion leads to inhibition of adenylcyclase but also decreases agonist-promoted phosphorylation and receptor desensitization . Functionally, carriers of this deletion variant exhibit:

• Enhanced memory for emotional vs. neutral pictures compared to non-carriers

• Higher amygdala activation in response to negative vs. neutral pictures

• Increased functional connectivity between the amygdala and insula during emotional processing

• In trauma survivors, higher scores for re-experiencing traumatic memories

The deletion appears to act primarily as a loss-of-function polymorphism in the regulation of emotional memories, potentially resulting in increased noradrenergic availability in response to emotional events .

What are the key specifications of commercially available Recombinant Dugong dugon ADRA2B?

Currently available recombinant Dugong dugon ADRA2B proteins vary in their specifications. Two main variants are documented in research supplies:

Table 1: Comparison of Available Recombinant Dugong dugon ADRA2B Products

The full amino acid sequence of the full-length product is documented as: AIATVITFLILFTIFGNSLVILAVLTSRSLRAPQNLFLVSLAAADIMVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSHRRGPGAKGGPRKGESKQPHSLDSGPSALANLPTLASSLAVAGEANGHSMP PGEKERETSEDPGTPTLPPSWPVLPNSGQGQKGGVCGASLEEEADKEEEEECGPPAVPAS SPATACNPPLQQPQGSQVLATLRGQVFLGRGVGAAGGQWWRRWAQLTREKRFTFVLAVVIG VFVLCWFPFFFSYSLGAICPQHCKVPHGLF .

What reconstitution methods are recommended for lyophilized Recombinant Dugong dugon ADRA2B?

The recommended reconstitution protocol for lyophilized Recombinant Dugong dugon ADRA2B involves:

• Brief centrifugation of the vial prior to opening to bring contents to the bottom

• Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommended concentration)

• Aliquoting for long-term storage at -20°C/-80°C

This method helps maintain protein stability and prevents repeated freeze-thaw cycles, which can degrade protein quality. Working aliquots can be stored at 4°C for up to one week .

How does the expression system affect the properties of Recombinant Dugong dugon ADRA2B?

The choice of expression system significantly impacts the properties of the recombinant protein:

• E. coli expression system: Provides high yields but lacks post-translational modifications, particularly glycosylation. The E. coli-expressed full-length ADRA2B (product RFL-10286DF) may have differences in folding compared to the native protein, potentially affecting functional studies requiring proper receptor conformation .

• Yeast expression system: The partial ADRA2B product (CSB-YP001389DMV1) expressed in yeast likely exhibits some eukaryotic post-translational modifications, making it potentially more suitable for certain functional and structural studies .

Researchers should select the appropriate expression system based on their experimental requirements: E. coli-expressed proteins are often suitable for antibody production and structural studies, while yeast-expressed proteins may be preferable for functional assays where post-translational modifications are important.

How can Recombinant Dugong dugon ADRA2B be used in receptor-ligand binding studies?

For receptor-ligand binding studies with Recombinant Dugong dugon ADRA2B, researchers should consider the following methodological approach:

• Membrane Preparation:

  • If using the full-length receptor, reconstitute in a buffer containing phospholipids to form proteoliposomes

  • Use gentle detergents (e.g., n-dodecyl-β-D-maltoside) at concentrations below critical micelle concentration to maintain receptor integrity

• Binding Assay Setup:

  • Employ radioligand binding assays using tritium (³H) or iodine-125 (¹²⁵I) labeled alpha-adrenergic ligands

  • For fluorescence-based alternatives, use fluorescent alpha-adrenergic ligands with techniques such as fluorescence polarization or FRET

• Data Analysis:

  • Generate saturation binding curves to determine Kd (dissociation constant) and Bmax (maximum binding capacity)

  • Compare binding parameters between Dugong ADRA2B and other species' ADRA2B to identify evolutionary differences

• Controls:

  • Include competitive binding with known alpha-2 adrenergic agonists (e.g., clonidine) and antagonists (e.g., yohimbine)

  • Use species-matched control proteins to validate binding specificity

This methodological framework enables researchers to characterize the pharmacological properties of Dugong ADRA2B and compare them with other species or genetic variants.

What functional assays are appropriate for studying the signaling properties of Recombinant Dugong dugon ADRA2B?

To evaluate the signaling properties of Recombinant Dugong dugon ADRA2B, the following functional assays are recommended:

• G-protein coupling assays:

  • [³⁵S]GTPγS binding assay to measure G-protein activation following receptor stimulation

  • Bioluminescence Resonance Energy Transfer (BRET) assays to monitor receptor-G protein interactions in real-time

• Second messenger assays:

  • Measurement of cAMP inhibition using enzyme immunoassay (EIA) or ELISA techniques

  • FLIPR-based calcium flux assays if the receptor couples to Gq proteins

• Receptor internalization and trafficking:

  • Fluorescently-tagged receptor constructs to monitor trafficking using confocal microscopy

  • Flow cytometry to quantify surface expression levels before and after agonist stimulation

• Functional selectivity studies:

  • Multiplex assays that simultaneously measure multiple downstream pathways (G-protein vs. β-arrestin)

  • Phosphoproteomic analysis to identify differential phosphorylation patterns

These methodological approaches would need to be optimized specifically for the Dugong ADRA2B, taking into account the potential differences in optimal buffer conditions, temperature, and ligand concentrations compared to more commonly studied species.

How can comparative studies between Dugong ADRA2B and human ADRA2B variants be designed?

To design robust comparative studies between Dugong ADRA2B and human ADRA2B variants:

• Expression system standardization:

  • Express both receptors in the same cellular background (e.g., HEK293 cells) to minimize system-dependent variables

  • Use equivalent promoters and expression cassettes to achieve comparable expression levels

• Structural comparison approaches:

  • Conduct molecular modeling based on available crystal structures of related GPCRs

  • Perform targeted mutagenesis of divergent residues to identify functionally important differences

• Pharmacological profiling:

  • Test a panel of alpha-adrenergic ligands including endogenous (norepinephrine, epinephrine) and synthetic compounds

  • Determine full dose-response curves to extract efficacy (Emax) and potency (EC50) parameters

• Comparative signaling dynamics:

  • Examine temporal aspects of signaling using real-time assays

  • Investigate differences in receptor desensitization, internalization, and recycling rates

• Bioinformatic analysis:

  • Perform sequence alignments focusing on key receptor domains (ligand binding pocket, G-protein coupling interface)

  • Use evolutionary trace methods to identify functionally divergent residues between species

This cross-species comparative approach would be particularly valuable for understanding the evolutionary adaptations of adrenergic signaling in marine mammals compared to terrestrial species, potentially revealing adaptations related to diving physiology and stress responses.

How does the functional deletion variant of ADRA2B influence amygdala activity and emotional memory?

Research on human ADRA2B variants provides important insights that may guide studies with the Dugong receptor. The functional deletion variant of ADRA2B has been shown to significantly impact amygdala activity and emotional memory processing through several mechanisms:

• Enhanced amygdala activation: fMRI studies demonstrate that carriers of the ADRA2B deletion variant exhibit increased amygdala activation during encoding of photographs with negative emotional valence compared to non-carriers . This heightened responsivity occurs specifically during the encoding phase of memory formation, suggesting early effects on memory processing .

• Altered neural connectivity: Functional connectivity analyses reveal that deletion carriers show significantly stronger connectivity between the amygdala and insula during emotional processing . Additional enhanced connectivity is observed between the right amygdala and left inferior frontal gyrus (Brodmann's area 47) and the left postcentral gyrus (Brodmann's area 3) .

• Behavioral correlates: Deletion carriers demonstrate enhanced memory for emotional pictures (113% ± 18%) compared to non-deletion carriers . In trauma survivors, carriers show higher trauma re-experiencing symptoms, indicating clinical relevance of this genetic variation .

• Molecular mechanisms: In vitro studies indicate that the deletion variant results in both inhibition of adenylcyclase and decreased agonist-promoted phosphorylation and receptor desensitization . The behavioral and imaging data suggest the deletion acts primarily as a loss-of-function polymorphism of the α2b-adrenergic receptor in emotional memory regulation, potentially leading to increased noradrenergic availability during emotional events .

These findings highlight how genetic variation in adrenergic signaling can influence neural circuits involved in emotional processing and memory formation, providing a framework for comparative studies with the Dugong ADRA2B.

What is the significance of studying ADRA2B across different species, particularly marine mammals?

Studying ADRA2B across different species, especially in marine mammals like the Dugong, offers several important research opportunities:

• Evolutionary adaptations in stress response systems:

  • Marine mammals face unique physiological challenges including dive-related hypoxia and pressure changes

  • Comparative analysis may reveal adaptations in adrenergic signaling related to stress management during diving

• Comparative neurobiology of memory systems:

  • Investigating whether marine mammals show similar emotional memory processing mechanisms to terrestrial mammals

  • Understanding if specialized adaptations exist for memory formation in aquatic environments

• Pharmacological diversity:

  • Identifying species-specific pharmacological profiles that may inform drug discovery

  • Exploring natural variations in receptor function that confer resistance or sensitivity to certain compounds

• Conservation physiology:

  • Understanding stress physiology in threatened species like the Dugong

  • Developing biomarkers for assessing stress impacts in conservation management

• Evolutionary genomics:

  • Tracing the evolutionary history of adrenergic receptors across mammalian lineages

  • Identifying convergent or divergent evolution in marine mammal lineages

These comparative studies can provide unique insights into both basic biology and potential applications in human medicine, particularly regarding stress resilience mechanisms and stress-related memory disorders.

What potential applications exist for research on Recombinant Dugong dugon ADRA2B in understanding stress responses?

Research on Recombinant Dugong dugon ADRA2B offers several potential applications for understanding stress responses:

• Comparative pharmacology for stress management:

  • Screening of compounds against Dugong ADRA2B may identify novel ligands with unique properties

  • Development of species-specific pharmacological profiles to understand differential stress responses

• Adaptation to environmental stressors:

  • Investigation of receptor signaling adaptations related to marine mammal diving physiology

  • Examination of how receptor structure-function relationships adapt to hypoxic conditions

• Biomarker development:

  • Utilization of knowledge about receptor variants to develop biomarkers for stress assessment in marine mammals

  • Application of findings to conservation monitoring of threatened dugong populations

• Translational research for stress-related disorders:

  • Insights from naturally occurring variations in marine mammal ADRA2B may inform research on human stress resilience

  • Potential applications in understanding or treating PTSD, given the established role of ADRA2B variants in traumatic memory processing

• Evolutionary medicine:

  • Understanding how evolutionary pressures have shaped adrenergic signaling across different ecological niches

  • Identification of convergent solutions to stress management across phylogenetically distant species

These research directions highlight the broader significance of studying the Dugong ADRA2B beyond basic receptor characterization.

What are common challenges in working with recombinant adrenergic receptors and how can they be addressed?

Working with recombinant adrenergic receptors presents several technical challenges:

• Maintaining native conformation:

  • Challenge: GPCRs like ADRA2B often misfold when expressed recombinantly

  • Solution: Use mild detergents (DDM, LMNG) at concentrations just above CMC; consider adding cholesterol hemisuccinate; explore nanodiscs or other membrane mimetics for functional studies

• Protein stability issues:

  • Challenge: Rapid degradation during purification and storage

  • Solution: Maintain constant cold temperature (4°C) during purification; add protease inhibitors; consider fusion partners (T4 lysozyme, BRIL) that enhance stability; store at -80°C with 50% glycerol as recommended for the Dugong ADRA2B products

• Low expression yields:

  • Challenge: Membrane proteins typically express at lower levels than soluble proteins

  • Solution: Optimize codon usage for expression system; use stronger promoters; consider inducible expression systems; explore specialized E. coli strains (C41, C43) for membrane protein expression

• Functional assessment difficulties:

  • Challenge: Confirming proper folding and functionality

  • Solution: Employ ligand binding assays with well-characterized ligands; use thermal shift assays to assess stability; validate with multiple orthogonal functional assays

• Batch-to-batch variability:

  • Challenge: Inconsistent results between protein preparations

  • Solution: Implement rigorous quality control protocols; consider internal standards; document all production parameters carefully

These solutions are applicable to work with Recombinant Dugong dugon ADRA2B and should be adapted based on the specific research objectives and available resources.

How can researchers optimize storage conditions to maintain the activity of Recombinant Dugong dugon ADRA2B?

To optimize storage conditions and maintain activity of Recombinant Dugong dugon ADRA2B:

• Short-term storage (up to one week):

  • Store working aliquots at 4°C as recommended in product documentation

  • Maintain in buffer containing protease inhibitors and reducing agents

  • Avoid repeated temperature changes

• Long-term storage:

  • Store at -20°C/-80°C as recommended, with -80°C preferred for extended periods

  • Add glycerol to a final concentration of 50% to prevent ice crystal formation

  • Divide into single-use aliquots to avoid repeated freeze-thaw cycles

• Reconstitution considerations:

  • Follow the recommended reconstitution protocol using deionized sterile water

  • Reconstitute to concentrations between 0.1-1.0 mg/mL as suggested in product documentation

  • Allow protein to fully hydrate before experimental use

• Stability monitoring:

  • Implement regular quality control tests on stored samples

  • Use functional assays or thermal shift assays to assess activity retention

  • Document storage conditions and duration for all experiments to account for potential variability

• Transportation:

  • Transport on dry ice when shipping between facilities

  • Minimize time at temperatures between freezing and refrigeration

  • Consider shipping in lyophilized form when possible

These optimized storage protocols can significantly extend the shelf life and maintain the functional integrity of the recombinant protein for research applications.

What controls should be included when designing experiments with Recombinant Dugong dugon ADRA2B?

When designing rigorous experiments with Recombinant Dugong dugon ADRA2B, researchers should include the following controls:

• Positive controls:

  • Well-characterized human or other mammalian ADRA2B proteins with established activity profiles

  • Known ligands with defined pharmacological parameters (e.g., yohimbine, clonidine)

  • Positive control cell lines expressing endogenous alpha-2 adrenergic receptors

• Negative controls:

  • Heat-denatured receptor preparations to control for non-specific effects

  • Buffer-only conditions to establish baseline measurements

  • Competitive binding with non-specific ligands to demonstrate specificity

• Expression system controls:

  • Mock-transfected or mock-induced cells processed identically to receptor-expressing systems

  • Expression host cells without the recombinant protein to control for endogenous activity

  • Different expression systems (E. coli vs. yeast) to account for system-specific artifacts

• Assay-specific controls:

  • For binding studies: non-specific binding determination using excess unlabeled ligand

  • For functional assays: positive control stimuli that bypass receptor activation

  • For structural studies: properly folded control membrane proteins of similar size

• Technical controls:

  • Multiple batches of the recombinant protein to assess reproducibility

  • Concentration gradients to establish dose-dependency

  • Time-course measurements to capture optimal signal windows

Including these comprehensive controls ensures experimental rigor and facilitates the proper interpretation of results when working with this specialized receptor protein.