Recombinant Dugong dugon ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Table 2: Production Details

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based buffer, 50% glycerol
ApplicationsELISA, enzyme activity assays, structural studies

Functional Role in Mitochondrial Disorders

Mutations in MT-ATP6 are linked to mitochondrial diseases such as Leigh syndrome (10% of cases), neuropathy, ataxia, and retinitis pigmentosa (NARP), and Charcot-Marie-Tooth disease . Pathogenic variants (e.g., m.8993T>G) disrupt ATP synthase function, leading to impaired oxidative phosphorylation and cellular energy deficits .

Table 3: Pathogenic Variants and Biochemical Effects

VariantClinical PhenotypeBiochemical DefectReference
m.8993T>GLeigh syndrome, NARPReduced ATP synthesis, increased mitochondrial membrane potential
m.9176T>GNeurodegenerationImpaired proton pumping efficiency
m.9185T>CMovement disordersDecreased mitochondrial membrane potential, unstable Complex V

Research Applications and Findings

Recombinant MT-ATP6 facilitates studies on ATP synthase assembly, proton transport, and drug interactions. Key findings include:

  • Yeast Modeling: Mutant variants (e.g., p.I106T, p.V142I) introduced into yeast atp6 models showed preserved ATP hydrolysis but reduced ATP synthesis, mirroring human pathology .

  • Biochemical Assays: Pathogenic variants exhibit diverse defects, including abnormal oligomycin sensitivity and altered proton translocation efficiency .

  • Therapeutic Targets: Research emphasizes restoring ATP synthase stability or enhancing residual enzyme activity .

Clinical and Mechanistic Insights

  • Energy Sensitivity: Tissues with high metabolic demand (brain, muscle) are most affected by MT-ATP6 mutations due to ATP depletion .

  • Heteroplasmy Threshold: Disease severity correlates with mutant mitochondrial DNA load (e.g., >90% for Leigh syndrome vs. 70–90% for NARP) .

  • Complex V Assembly: Subunits a and A6L stabilize ATP synthase dimers/oligomers; mutations disrupt this interaction, reducing enzyme stability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this may serve as a useful guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag, please inform us in advance; we will prioritize your request.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Dugong dugon (Dugong) (Trichechus dugon)
Target Names
Target Protein Sequence
MNENLFTSFITPTMMGLPIVILVIVFPAMLYPSPNRLINNRLISIQQWLVQLILKQMLLI HNSKGRTWALMLISLILFIGSTNLLGLVPYTFTPTTQLSMNLGMAIPLWAGAVITGFRHK AKASLAHFLPQGTPITLIPMLVVIETISLFIQPMALAIRLTANITAGHLLMHLIGGAVLA LTSISPAAATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using a proton gradient across the mitochondrial membrane. This gradient is generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. Subunit a is a key component of the proton channel, potentially directly involved in proton translocation across the membrane.

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its function in Dugong dugon?

MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6) forms a critical subunit of the large, transmembrane F-type ATP synthase complex (Complex V) in Dugong dugon mitochondria. This protein plays an essential role in the final step of oxidative phosphorylation within the electron transport chain . Specifically, the MT-ATP6 subunit helps create a channel that allows protons to flow across the specialized inner mitochondrial membrane, generating the electrochemical gradient necessary for ATP production . The energy created by this proton flow enables another segment of the enzyme to convert adenosine diphosphate (ADP) to adenosine triphosphate (ATP), the cell's primary energy source .

In Dugong dugon, the MT-ATP6 protein consists of 226 amino acids forming part of the non-catalytic, transmembrane F₀ portion of the ATP synthase complex . This subunit's structure and function are highly conserved across species, reflecting its fundamental importance in cellular energy production, though species-specific adaptations may exist to accommodate the unique physiological demands of marine mammals.

What is the complete amino acid sequence of Dugong dugon MT-ATP6 and how is it characterized?

The complete amino acid sequence of Dugong dugon MT-ATP6 consists of 226 amino acids as follows:

MNENLFTSFITP TMMGLPIVILVI VFPAmLYPSPNR LINNRLISIQQ WLVQLILKQmLLI HNSKGRTWAL mLISLILFIGS TNLLGLVPYTF TPTTQLSMNLG MAIPLWAGAVI TGFRHKAKASL AHFLPQGTPIT LIPmLVVIETI SLFIQPMALAI RLTANITAGHL LMHLIGGAVLA LTSISPAAATI TFIILLLLILE FAVALIQAYVF TLLVSLYLHDN T

This protein is characterized by several important features:

  • UniProt accession number: Q8W9N1

  • Recommended name: ATP synthase subunit a

  • Alternative name: F-ATPase protein 6

  • Gene name: MT-ATP6 (synonyms: ATP6, ATPASE6, MTATP6)

  • Expression region: 1-226 (full-length protein)

The sequence contains multiple hydrophobic regions consistent with its role as a transmembrane protein, particularly important for forming the proton channel within the inner mitochondrial membrane. Computational analysis suggests the presence of several transmembrane domains that anchor the protein within the mitochondrial membrane.

What storage and handling conditions are optimal for recombinant Dugong dugon MT-ATP6?

For successful experimental work with recombinant Dugong dugon MT-ATP6, proper storage and handling are critical to maintain protein stability and functionality. The following conditions have been established as optimal:

Storage buffer composition:

  • Tris-based buffer (optimized specifically for this protein)

  • 50% glycerol as a stabilizing agent

Temperature requirements:

  • Store at -20°C for routine storage

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots should be maintained at 4°C for up to one week

Important handling considerations:

  • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity

  • Create multiple small working aliquots during initial processing to minimize freeze-thaw cycles

  • When removing from storage, thaw samples quickly and maintain at appropriate working temperature

These recommendations reflect the general requirements for membrane proteins and have been specifically optimized for recombinant Dugong dugon MT-ATP6 to ensure maximum stability and activity retention for experimental applications.

What expression systems are most effective for producing functional recombinant Dugong dugon MT-ATP6?

The selection of an appropriate expression system is critical for obtaining functional recombinant Dugong dugon MT-ATP6. Research indicates that several systems can be employed, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Applications
Bacterial (E. coli)High yield, cost-effective, rapid productionLimited post-translational modifications, potential for inclusion bodiesStructural studies, antibody production
Insect cell/baculovirusBetter protein folding than bacteria, moderate yieldMore complex than bacterial systemsFunctional studies requiring proper folding
Mammalian cellsNative-like post-translational modifications, proper foldingLower yield, higher cost, longer production timeInteraction studies, functional assays
Cell-free systemsRapid production, good for toxic proteinsLimited scale, relatively expensiveInitial screening, pilot studies

For functional studies of Dugong dugon MT-ATP6, insect cell expression systems often provide the best balance between yield and proper protein folding. When producing this protein, several critical factors must be considered:

  • Codon optimization for the expression host

  • Addition of appropriate purification tags that minimally impact function

  • Incorporation of proper signal sequences if required

  • Optimization of induction conditions and harvest timing

Success in producing functional recombinant MT-ATP6 typically requires careful optimization of expression parameters and may benefit from fusion partners that enhance solubility while maintaining the protein's native conformation and functionality.

What analytical methods are most appropriate for assessing the functional integrity of recombinant Dugong dugon MT-ATP6?

Assessing the functional integrity of recombinant Dugong dugon MT-ATP6 requires multiple complementary analytical approaches to evaluate different aspects of protein structure and function:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Limited proteolysis combined with mass spectrometry to confirm proper folding

    • Size exclusion chromatography to assess oligomeric state and aggregation tendency

  • Functional activity assays:

    • Reconstitution into liposomes for proton translocation measurements

    • ATP synthesis assays in reconstituted systems

    • Membrane potential measurements using fluorescent probes

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking studies to evaluate complex formation

  • Quality control metrics:

    • Purity assessment via SDS-PAGE and western blotting

    • Mass spectrometry for accurate mass determination and sequence verification

    • Thermal stability assessment using differential scanning fluorimetry

A comprehensive analysis would typically involve a combination of these approaches, with particular emphasis on functional reconstitution assays that directly assess the protein's ability to participate in proton translocation, which is its primary physiological function within the ATP synthase complex.

How can researchers effectively distinguish between functional differences and experimental artifacts when comparing Dugong dugon MT-ATP6 with other species?

When conducting comparative studies between Dugong dugon MT-ATP6 and orthologs from other species, distinguishing genuine functional differences from experimental artifacts requires rigorous experimental design and controls:

  • Standardized expression and purification:

    • Process all proteins being compared through identical expression systems

    • Utilize the same purification protocols and buffer conditions

    • Verify comparable purity levels and concentration determination methods

  • Multiple independent preparations:

    • Generate at least three independent protein preparations

    • Perform technical replicates of all functional assays

    • Apply appropriate statistical analyses to determine significance

  • Complementary methodological approaches:

    • Employ multiple orthogonal techniques to assess the same functional parameter

    • Validate observations across different experimental conditions

    • Use both in vitro and cellular systems when possible

  • Controls for species-specific factors:

    • Include chimeric constructs swapping specific domains between species

    • Perform site-directed mutagenesis to test the contribution of specific residues

    • Use reconstituted systems with defined lipid compositions

  • Data validation framework:

Validation ApproachImplementationPurpose
Positive controlsKnown functional mutants or inhibitorsConfirm assay sensitivity
Negative controlsDenatured protein or empty vectorEstablish baseline and non-specific effects
Concentration dependenceTitration of protein amountsConfirm linear response range
Environmental robustnessTesting in varying pH, temperature, salt conditionsIdentify condition-dependent differences
Independent method validationDifferent techniques measuring same parameterCross-validation of observations

By implementing these approaches, researchers can more confidently attribute observed differences to genuine functional adaptations in Dugong dugon MT-ATP6 rather than experimental variables or artifacts.

How does the Dugong dugon MT-ATP6 sequence compare with those from other marine mammals, and what evolutionary insights can be gained?

Comparative analysis of Dugong dugon MT-ATP6 with other marine mammals reveals important evolutionary patterns that reflect both shared adaptations to aquatic life and lineage-specific specializations:

The Dugong dugon MT-ATP6 sequence shows several interesting patterns when compared to other marine mammals (cetaceans, pinnipeds) and terrestrial relatives:

  • Convergent evolution: Despite independent adaptation to marine environments, Dugong MT-ATP6 shares certain amino acid substitutions with distantly related marine mammals like whales and dolphins, particularly in regions associated with proton channel function .

  • Sirenian-specific features: Several unique residues distinguish the Dugong sequence from other marine mammals, likely reflecting the distinct evolutionary history of sirenians and their specific ecological niche as herbivorous marine mammals .

  • Conserved functional domains: Regions critical for proton translocation show high conservation across all mammals, indicating functional constraints regardless of environment .

Evolutionary rate analysis suggests that following transition to marine life, MT-ATP6 experienced episodes of accelerated evolution in multiple marine mammal lineages, potentially reflecting adaptation to the bioenergetic challenges of aquatic existence. These adaptations may relate to:

  • Enhanced ATP production efficiency during diving

  • Optimization for function under fluctuating oxygen availability

  • Temperature adaptations for marine environments

  • Specialized energy metabolism supporting marine mammal physiology

These evolutionary insights provide valuable context for understanding both the core functions of MT-ATP6 and the specific adaptations that may contribute to the unique physiological capabilities of Dugong dugon.

What structural and functional differences might exist between Dugong dugon MT-ATP6 and human MT-ATP6, and how might these inform disease research?

Comparing Dugong dugon MT-ATP6 with human MT-ATP6 reveals both conserved features essential for function and potentially informative differences that may have implications for human disease research:

  • Structural comparison:

    • Both proteins contain 226 amino acids with similar hydrophobicity profiles

    • Key functional residues involved in proton translocation are highly conserved

    • Differences primarily occur in transmembrane domains and at subunit interfaces

  • Disease-relevant regions:

    • In humans, mutations in MT-ATP6 are associated with several mitochondrial disorders including Leigh syndrome, a progressive brain disorder affecting approximately 10-20% of cases

    • The most common human pathogenic mutation (T8993G) causes a leucine-to-arginine substitution that severely impairs ATP synthase function

    • Analyzing corresponding regions in Dugong MT-ATP6 may reveal naturally occurring variations that mitigate potential pathogenic effects

  • Functional implications:

    • Comparative functional studies could identify residues that confer resilience or vulnerability to dysfunction

    • Dugong-specific adaptations might provide insights into alternative functional mechanisms

    • Understanding how different amino acid compositions affect protein stability and function could inform therapeutic approaches

This comparative approach could be particularly valuable for understanding the molecular basis of human mitochondrial diseases and potentially identifying novel therapeutic targets or strategies based on natural variations that provide functional advantages in other species .

How might the metabolic adaptations reflected in Dugong dugon MT-ATP6 relate to the species' unique ecological niche?

The structure and function of Dugong dugon MT-ATP6 likely reflect specialized metabolic adaptations suited to the species' unique ecological niche as marine herbivores. Several features of this protein may contribute to the dugong's specialized physiology:

  • Diving adaptations:

    • Modifications in proton channel architecture may support efficient ATP production under the hypoxic conditions experienced during diving

    • Potential optimization for function during transitions between aerobic and anaerobic metabolism

    • Structural adaptations that maintain function under pressure changes associated with diving

  • Dietary specialization:

    • As marine herbivores feeding primarily on seagrasses, dugongs have specific energetic requirements

    • MT-ATP6 adaptations may support efficient energy extraction from a high-fiber, relatively low-energy diet

    • Optimizations for sustained, low-intensity activity rather than burst swimming

  • Thermoregulatory considerations:

    • Unlike cetaceans, dugongs have relatively thin blubber layers and limited insulation

    • MT-ATP6 function may be adapted to support metabolic heat production

    • Potential resilience to temperature fluctuations in shallow coastal habitats

  • Marine environment adaptations:

    • Potential modifications related to osmoregulation and salt balance

    • Adaptations to support metabolic processes in a marine ionic environment

    • Structural features that provide resilience to environmental stressors

Understanding these adaptations provides valuable insights into how evolutionary processes have shaped MT-ATP6 structure and function to support the specialized physiological requirements of this unique marine mammal in its ecological context.

How can recombinant Dugong dugon MT-ATP6 be utilized to investigate mitochondrial disease mechanisms?

Recombinant Dugong dugon MT-ATP6 represents a valuable tool for investigating mitochondrial disease mechanisms, particularly those involving ATP synthase dysfunction:

  • Comparative mutational analysis:

    • Human pathogenic mutations (such as those causing Leigh syndrome) can be introduced into recombinant Dugong MT-ATP6

    • Functional consequences can be compared between human and Dugong variants

    • This approach may identify species-specific compensatory mechanisms that could inform therapeutic strategies

  • Structure-function relationship studies:

    • The 3D structural context of disease-associated residues can be examined

    • Chimeric constructs combining human and Dugong domains can pinpoint critical functional regions

    • Identification of residues that confer resistance to dysfunction in the Dugong protein

  • Experimental disease models:

    • Recombinant proteins can be incorporated into in vitro systems mimicking diseased states

    • The impact of potential therapeutic agents can be tested in controlled biochemical systems

    • Comparisons across species can reveal universal versus species-specific disease mechanisms

  • Comparative experimental approach:

Investigation ApproachMethodologyExpected Insight
Pathogenic mutation testingSite-directed mutagenesis and functional assaysSeverity of functional impact across species
Compensatory mutation screeningSecond-site mutations in disease backgroundsPotential rescue mechanisms
Structural analysisCryo-EM or crystallography of wild-type and mutant formsStructural basis of dysfunction
Protein-protein interaction studiesCo-IP, crosslinking with other ATP synthase subunitsImpact on complex assembly and stability

These approaches collectively offer the potential to uncover novel insights into mitochondrial disease mechanisms and potentially identify new therapeutic targets based on natural variations that provide functional resilience in Dugong dugon MT-ATP6 .

What novel insights might be gained from studying the bioenergetic efficiency of Dugong dugon MT-ATP6 under various physiological conditions?

Studying the bioenergetic efficiency of Dugong dugon MT-ATP6 under various physiological conditions can provide valuable insights into specialized adaptations that may have broader implications:

  • Oxygen availability adaptation:

    • Testing ATP synthase function under normoxic versus hypoxic conditions

    • Examining whether Dugong MT-ATP6 maintains efficiency during oxygen fluctuations

    • Investigating potential adaptations that optimize function during diving-induced hypoxia

  • Temperature response characteristics:

    • Measuring ATP synthesis rates across a range of temperatures reflecting the dugong's natural habitat

    • Comparing thermal stability with terrestrial mammal orthologs

    • Identifying structural features contributing to temperature adaptation

  • pH and ion sensitivity:

    • Evaluating function across pH gradients reflecting potential physiological variations

    • Testing sensitivity to different ion concentrations, particularly relevant to marine adaptations

    • Determining whether unique residues confer altered pH optimum compared to terrestrial mammals

  • Energy efficiency metrics:

    • Measuring ATP/ADP ratios under various conditions

    • Determining proton/ATP coupling efficiency

    • Assessing whether Dugong MT-ATP6 has evolved enhanced efficiency relevant to its ecological niche

Experimental data from these studies could reveal adaptations with potential applications in:

  • Understanding mechanisms of cellular energy efficiency

  • Developing bioinspired approaches to energy conversion

  • Informing therapeutic strategies for mitochondrial disorders

  • Advancing knowledge of physiological adaptations to challenging environments

The unique evolutionary history of Dugong dugon as a marine mammal makes its MT-ATP6 particularly valuable for studying specialized adaptations to aquatic life that may have broader implications for understanding bioenergetic principles .

What methodological approaches can be used to study the interaction between Dugong dugon MT-ATP6 and other ATP synthase subunits?

Understanding the interactions between Dugong dugon MT-ATP6 and other ATP synthase subunits requires sophisticated methodological approaches to capture these complex protein-protein interactions:

  • Biochemical interaction studies:

    • Co-immunoprecipitation with antibodies against MT-ATP6 or other subunits

    • Pull-down assays using tagged recombinant proteins

    • Crosslinking studies to capture transient or weak interactions

    • Blue Native PAGE to analyze intact complexes

  • Biophysical characterization:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Förster resonance energy transfer (FRET) for proximity analysis in reconstituted systems

  • Structural biology approaches:

    • Cryo-electron microscopy of assembled ATP synthase complexes

    • Cross-linking mass spectrometry (XL-MS) to identify interaction points

    • Integrative structural modeling combining multiple data sources

    • Single-particle analysis to examine conformational states

  • Functional interaction assessment:

    • Reconstitution of ATP synthase with wild-type or mutant MT-ATP6

    • Complementation studies in cellular models

    • Activity assays with systematically varied subunit compositions

    • Site-directed mutagenesis of predicted interface residues

Interaction FocusMethodological ApproachExpected Outcome
MT-ATP6/c-ring interfaceCrosslinking + MS analysisIdentification of contact residues
Assembly dynamicsTime-resolved native PAGETemporal sequence of complex formation
Interface stabilityHydrogen-deuterium exchangeMapping of protected regions
Conformational couplingSingle-molecule FRETDynamic structural rearrangements

These methodological approaches provide complementary information about the structural and functional interactions between MT-ATP6 and other subunits of the ATP synthase complex, offering insights into both the fundamental mechanisms of ATP synthesis and potential species-specific adaptations in Dugong dugon .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.