Recombinant Dugong dugon NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

MT-ND4L forms the hydrophobic core of Complex I, stabilizing its transmembrane domain. Its disruption due to mutations (e.g., T→C at position 10,663) is linked to Leber’s Hereditary Optic Neuropathy (LHON), impairing electron transport and ATP synthesis .

Key Activities:

  1. Electron Transfer: Facilitates redox reactions via Fe-S clusters and FMN prosthetic groups .

  2. Proton Pumping: Drives proton translocation across the mitochondrial membrane .

Clinical and Research Relevance

MT-ND4L variants are implicated in metabolic and neurodegenerative disorders:

Disease/PhenotypeAssociationSource
Leber’s Hereditary Optic NeuropathyValine-to-alanine mutation (V65A) disrupts Complex I function .
Obesity and Metabolic SyndromeLinked to increased BMI and insulin resistance in humans .
Research ApplicationsStudied in diabetes, neurodegeneration, and mitochondrial dysfunction .

Table 2: Gene Information

AttributeDetailSource
Gene ID4539 (Human) / Q8W9M8 (Dugong)
Chromosomal LocationMitochondrial DNA (non-nuclear)
Transcript Length297 bp (coding)

Table 3: Disease Associations

ConditionMechanismSource
LHONImpaired electron transport → ATP deficiency → retinal ganglion cell death
Diabetes MellitusReduced insulin sensitivity linked to mitochondrial dysfunction

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Dugong dugon (Dugong) (Trichechus dugon)
Target Names
Target Protein Sequence
MPFIYINILLAFFISFIGLLMYRSHLMSSLLCLEGMMLSLYILGTLLCLNMHFTLSAMIP MILLVFAACEAAVGLALLVMVSNTYGLDHVQNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NADH-ubiquinone oxidoreductase chain 4L in Dugong dugon?

NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) in Dugong dugon is a mitochondrially-encoded protein that serves as an essential component of the respiratory Complex I (NADH:ubiquinone oxidoreductase). This protein is embedded in the inner mitochondrial membrane and participates in the electron transport chain, specifically in the first step of transferring electrons from NADH to ubiquinone .

The MT-ND4L gene in Dugong dugon shows distinct nucleotide composition characteristics with 44.4% GC content and 55.6% AT content. The specific base distribution includes 87 guanine, 45 cytosine, 96 adenine, and 69 thymine bases . This composition may reflect evolutionary adaptations related to the marine environment and the metabolic demands of this species.

How does the MT-ND4L protein in Dugong dugon compare structurally to that of other marine mammals and terrestrial relatives?

The MT-ND4L protein in Dugong dugon shows distinctive characteristics when compared to both other marine mammals and its terrestrial relatives in the Paenungulata clade (elephants and hyraxes). Structural analysis reveals that while the core functional domains are conserved across mammalian species, there are notable differences in specific amino acid residues that likely reflect adaptations to the marine environment.

When examining phylogenetic relationships based on mitochondrial genomes, including MT-ND4L, data reveals two divergent Australian mitochondrial lineages in dugongs. One lineage is geographically restricted to Queensland and the Northern Territory, while another is more widespread across the entire Australian range . This suggests historical divergence during periods of low sea level that created geographical barriers.

Comparative analysis with other Sirenia (manatees) shows sequence divergence patterns that are diagnostically useful. For instance, restriction enzyme analysis of mitochondrial genes can differentiate between dugongs and the three Trichechus species (T. inunguis, T. manatus, and T. senegalensis) . This indicates structural variations in the nucleotide sequences that affect restriction enzyme recognition sites.

The dugong's MT-ND4L appears to have evolved under specific selective pressures related to marine life, similar to adaptations observed in sea turtles where mitochondrial genes, particularly those in Complex I like ND4 and ND5, show evidence of positive selection related to mitochondrial adaptation to physiological stress from a more active marine lifestyle .

What are the optimal conditions for expression and purification of recombinant Dugong dugon MT-ND4L?

For optimal expression and purification of recombinant Dugong dugon MT-ND4L, E. coli-based expression systems have proven most effective according to current research protocols. Based on methodologies used for similar mitochondrial proteins, the following approach is recommended:

Expression System:

  • Use E. coli BL21(DE3) strain for high yield expression

  • Employ a pET-based vector system with an N-terminal His-tag for easy purification

  • Include rare codon supplementation (e.g., Rosetta strain) as mitochondrial genes often contain codons rarely used in E. coli

Expression Conditions:

  • Culture at 18-20°C after induction (rather than 37°C) to increase soluble protein yield

  • Use 0.1-0.5 mM IPTG for induction

  • Extend expression time to 16-18 hours post-induction at the lower temperature

Purification Protocol:

  • Lyse cells using a combination of lysozyme (1 mg/ml) and sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 1 mM PMSF

  • Include 0.5-1% mild detergent (e.g., n-dodecyl β-D-maltoside) in the lysis and purification buffers to maintain protein solubility

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

Storage:

  • For long-term storage, add 50% glycerol and store at -80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Working aliquots can be maintained at 4°C for up to one week

The recombinant protein typically achieves >85% purity as assessed by SDS-PAGE. For verification of structural integrity, circular dichroism spectroscopy is recommended to confirm proper folding of the recombinant protein.

What molecular techniques are most effective for studying MT-ND4L mutations and variations in Dugong populations?

The most effective molecular techniques for studying MT-ND4L mutations and variations in Dugong populations incorporate a combination of targeted amplification, next-generation sequencing, and population genetics analyses:

DNA Extraction and Initial Amplification:

  • For dugong samples, modified CTAB (cetyltrimethylammonium bromide) extraction protocols yield high-quality mtDNA

  • Long-range PCR using LA Taq DNA polymerase can amplify the entire mitochondrial genome in two overlapping fragments

  • PCR conditions: initial denaturation at 94°C for 1 min, followed by 30 three-step cycles (94°C for 30s, 60°C for 30s, 72°C for 6 min), with final extension at 72°C for 5 min

Mutation and Variation Detection:

  • PCR-RFLP (Restriction Fragment Length Polymorphism) analysis using enzymes such as BanI, EcoRV, HpyCH4III, and MwoI can reveal polymorphic sites and distinguish between Dugong dugon and related species

  • Direct Sanger sequencing of the MT-ND4L gene provides comprehensive variation data

  • Next-generation sequencing of mitochondrial DNA allows detection of heteroplasmy and low-frequency variants

Population Genetic Analysis:

  • Mitochondrial control region sequencing complements MT-ND4L analysis for population structure studies

  • Nested clade phylogeographic analysis (NCPA) helps interpret the geographic association of haplotypes

  • Analysis of Molecular Variance (AMOVA) quantifies the genetic variation within and between dugong populations

Data Interpretation Framework:

Analysis LevelTechniquesOutcomes
IndividualSanger sequencing, NGSIdentification of novel mutations, heteroplasmy levels
PopulationRFLP, haplotype network analysisPopulation structure, genetic diversity indices
SpeciesPhylogenetic analysis, dN/dS calculationsSelection pressure, evolutionary relationships

For studies focusing on conservation genetics, combining these approaches with nuclear microsatellite analysis provides a more complete picture of dugong population dynamics, showing patterns such as male-biased gene flow as observed in Australian dugong populations .

How has the MT-ND4L gene evolved in Dugong dugon compared to other members of Sirenia and Paenungulata?

The evolutionary trajectory of MT-ND4L in Dugong dugon reveals important insights into sirenian evolution and adaptation to marine environments. Comparative analysis with other members of Sirenia (manatees) and the broader Paenungulata clade (elephants and hyraxes) shows distinctive patterns:

Phylogenetic Context:
MT-ND4L sequence data contributes to resolving relationships within Paenungulata, where rapid radiation followed by deep divergence has resulted in limited phylogenetic signal. While morphological data favors grouping Sirenia with Proboscidea (elephants) as Tethytheria to the exclusion of Hyracoidea (hyraxes), molecular data strongly supports Paenungulata as a clade but shows ambiguity in intra-ordinal relationships .

Nucleotide Composition and Selection Pressures:
The MT-ND4L gene in Dugong dugon shows a distinctive nucleotide composition (44.4% GC, 55.6% AT) , which differs from the patterns observed in terrestrial relatives. This composition may reflect adaptations to the marine environment and metabolic requirements.

Evolutionary Rate Analysis:
Comparative rate analysis indicates that MT-ND4L in Sirenia has experienced different selective pressures compared to terrestrial mammals. Similar to patterns observed in sea turtles, there is evidence of increased evolutionary rates (dN/dS ratios) in mitochondrial OXPHOS genes of marine mammals, particularly in NADH dehydrogenase subunits . This accelerated evolution likely reflects adaptation to the energetic demands of marine life.

Diagnostic Molecular Markers:
MT-ND4L sequence variations serve as important markers for species identification within Sirenia. Specific single nucleotide polymorphisms (SNPs) and restriction sites differentiate Dugong dugon from the three Trichechus species (T. inunguis, T. manatus, and T. senegalensis) . These diagnostic sites reflect the evolutionary divergence between dugongs and manatees.

The evolutionary patterns observed in MT-ND4L contribute to our understanding of how marine mammals have adapted their energy metabolism to aquatic environments and provide insights into the broader evolutionary history of Paenungulata within Afrotheria.

What evidence exists for natural selection acting on MT-ND4L in marine mammals including Dugong dugon?

Compelling evidence suggests that natural selection has shaped the evolution of MT-ND4L and other mitochondrial genes in marine mammals, including Dugong dugon. This selective pressure likely relates to the metabolic adaptations required for marine life:

Molecular Signatures of Selection:
Analysis of nonsynonymous to synonymous substitution ratios (dN/dS or ω) reveals relatively increased values for several OXPHOS genes, including Complex I components like MT-ND4L, in marine mammals . Similar patterns observed in sea turtles suggest this is a convergent adaptive response to marine environments.

Codon-Specific Selection:
While comprehensive codon-specific selection analysis has not been published specifically for MT-ND4L in dugongs, studies in related marine species have identified positively selected codons in other NADH dehydrogenase genes (ND4 and ND5) . These adaptive changes likely affect protein function in ways that optimize energy production under the physiological demands of marine life.

Comparative Evidence:
The pattern of selection in MT-ND4L should be viewed in the context of mitochondrial genome evolution as a whole. Accelerated evolutionary rates found in multiple mitochondrial genes (COX2, ND1, CYTB, ND4, and ND5) across marine lineages suggest adaptation to mitochondrial stress resulting from more active lifestyles in aquatic environments .

Functional Implications:
The selective pressure on MT-ND4L and other Complex I components likely relates to:

  • Adaptation to sustained deep diving behavior requiring efficient oxygen utilization

  • Modified energy metabolism for an aquatic lifestyle

  • Response to temperature differences in marine environments

  • Adaptations to salinity effects on cellular physiology

These selective pressures are particularly relevant for understanding how dugongs, with their herbivorous diet and marine lifestyle, have optimized energy production systems differently from terrestrial mammals. The molecular footprints of positive selection in MT-ND4L and related genes provide important insights into the physiological adaptations that enabled the successful colonization of marine habitats.

How can recombinant Dugong dugon MT-ND4L be used to investigate mitochondrial dysfunction in marine mammals?

Recombinant Dugong dugon MT-ND4L serves as a valuable tool for investigating mitochondrial dysfunction in marine mammals through several experimental approaches:

Structure-Function Analysis:
Crystal structure studies complemented by molecular dynamics simulations can elucidate how specific amino acid substitutions in dugong MT-ND4L affect protein stability and function. As demonstrated by Receptor.AI's comprehensive characterization approach, AI-driven conformational ensemble generation allows for exploring the broad conformational space of the protein and identifying representative structures that capture its dynamic behavior .

Disease Model Applications:
The recombinant protein can be used to develop in vitro models of mitochondrial disorders observed in marine mammals. For example, known mutations associated with Leber hereditary optic neuropathy in the MT-ND4L gene (such as the T10663C or Val65Ala mutation) can be introduced into the recombinant dugong protein to study their effects on Complex I assembly and function.

Biomarker Development:
The protein can serve as a standard for developing antibodies and immunoassays to detect MT-ND4L levels or modifications in tissue samples from stranded or deceased marine mammals. These assays could help identify mitochondrial dysfunction as a contributing factor to marine mammal strandings or deaths.

Conservation Applications:
Understanding the molecular basis of mitochondrial function in dugongs provides insights into their physiological adaptations and potential vulnerabilities to environmental stressors. This knowledge can inform conservation strategies for this vulnerable species, particularly in the context of changing marine environments due to human activities and climate change.

What are the implications of MT-ND4L mutations for dugong health and conservation?

Mutations in MT-ND4L have significant implications for dugong health and conservation, particularly given the protein's crucial role in energy metabolism:

Physiological Impact of Mutations:
Mutations in MT-ND4L can disrupt Complex I function, leading to decreased ATP production and increased reactive oxygen species (ROS) generation. In humans, mutations in this gene have been associated with Leber hereditary optic neuropathy , suggesting that similar mutations in dugongs could potentially impact vision or neurological function. Since dugongs rely heavily on their sensory systems for navigation and feeding in turbid waters, such impairments could significantly affect their survival.

Population Genetics Considerations:
MT-ND4L variations contribute to the genetic diversity patterns observed in dugong populations. Studies have identified two divergent Australian mitochondrial lineages with specific geographic distributions . Understanding the functional implications of these lineage-specific variations is essential for assessing population viability:

LineageGeographic DistributionConservation Implications
Lineage 1Queensland and Northern TerritoryLimited geographic range increases vulnerability
Lineage 2Widespread (Shark Bay to Moreton Bay)Greater range suggests more genetic resilience

Conservation Management:
The high level of gene flow detected in Australian dugong populations through nuclear DNA analysis, contrasted with mitochondrial lineage patterns, suggests male-biased gene flow . This pattern has important implications for conservation management:

  • Conservation units cannot be defined at a bay level due to genetic connectivity

  • Management strategies must be coordinated across thousands of kilometers

  • Cooperation between management agencies at local, state, national and international spatial scales is required

Monitoring and Research Priorities:
For effective conservation of dugongs, monitoring programs should incorporate:

  • Regular assessment of mitochondrial genetic diversity, particularly in MT-ND4L and other energy metabolism genes

  • Investigation of the functional impacts of observed MT-ND4L variations on dugong physiology

  • Integration of genetic data with environmental monitoring to identify potential stressors affecting mitochondrial function

Climate Change Vulnerability:
As climate change affects marine ecosystems, mutations in energy metabolism genes like MT-ND4L may become increasingly important in determining population resilience. Dugongs with variants that enable more efficient energy utilization under changing environmental conditions may have selective advantages in future scenarios.

What approaches can overcome the challenges in heterologous expression and functional reconstitution of Dugong dugon MT-ND4L?

Heterologous expression and functional reconstitution of Dugong dugon MT-ND4L present several challenges that require innovative approaches:

Challenges in Membrane Protein Expression:
MT-ND4L is a highly hydrophobic membrane protein, making traditional expression systems problematic. Advanced approaches to overcome these challenges include:

  • Cell-Free Expression Systems: Using specialized cell-free translation systems supplemented with lipids or detergents to facilitate proper folding of membrane proteins without cellular toxicity issues.

  • Fusion Protein Strategies: Creating fusion constructs with soluble protein partners (such as MBP or SUMO) that can be later cleaved, significantly improving expression yields and solubility.

  • Specialized Expression Hosts: Using Pichia pastoris or insect cell systems that are better suited for eukaryotic membrane protein expression than E. coli.

  • Codon Optimization: Implementing AI-driven codon optimization specifically designed for dugong mitochondrial genes expressed in heterologous systems, accounting for both codon bias and mRNA secondary structure.

Functional Reconstitution Approaches:
To study the functional properties of purified MT-ND4L:

  • Artificial Membrane Systems: Reconstituting the protein into nanodiscs or proteoliposomes with defined lipid compositions that mimic the inner mitochondrial membrane of marine mammals.

  • Co-expression Strategies: Developing systems for co-expression with other Complex I components to facilitate proper assembly and study of subcomplexes.

  • Activity Assays: Implementing sensitive electrochemical methods to detect the electron transfer activity of reconstituted complexes containing MT-ND4L under varying physiological conditions relevant to marine environments.

Structural Characterization:
For understanding the protein's structure-function relationship:

  • Cryo-EM Approaches: Applying single-particle cryo-electron microscopy to subcomplexes containing MT-ND4L to determine its structural context within Complex I.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Using HDX-MS to probe the conformational dynamics and interactions of MT-ND4L in membrane environments.

  • AI-Enhanced Structural Prediction: Implementing approaches similar to those used by Receptor.AI, including "AI-Driven Conformational Ensemble Generation" that can predict alternative functional states and explore conformational spaces that may be difficult to capture experimentally .

These advanced approaches provide pathways to overcome the significant technical challenges posed by this hydrophobic mitochondrial protein while yielding valuable insights into its function in the context of dugong physiology and evolution.

How can MT-ND4L sequence data contribute to resolving the controversial phylogenetic relationships within Paenungulata?

The phylogenetic relationships within Paenungulata (Hyracoidea, Sirenia, Proboscidea) remain contentious despite extensive study. MT-ND4L sequence data, when appropriately analyzed, can contribute to resolving this controversy through several sophisticated approaches:

Challenges in Paenungulate Phylogeny:
The Paenungulata clade presents a classic case of a rapid radiation followed by deep divergence, resulting in limited phylogenetic signal . While molecular data strongly support Paenungulata as a monophyletic group, the relationships among the three orders remain ambiguous. Morphological data tend to favor the Tethytheria hypothesis (Sirenia + Proboscidea), while molecular evidence has been inconsistent.

Advanced Phylogenomic Approaches:

  • Codon-Based Phylogenetic Models: Implementing complex codon substitution models that account for selection pressure variations across MT-ND4L sites and lineages can extract more accurate phylogenetic information than standard nucleotide models.

  • Site-Heterogeneous Models: Using models like CAT+GTR that account for site-specific amino acid preferences, which are particularly valuable for resolving deep divergences where compositional biases may confound traditional approaches.

  • Partition-Specific Rate Analysis: By treating different functional domains of MT-ND4L separately according to their evolutionary constraints, greater phylogenetic signal can be extracted from regions evolving under different selective regimes.

Integration with Multi-Gene Approaches:
MT-ND4L data should be integrated with other genetic markers in sophisticated ways:

  • Gene Tree Reconciliation Methods: Using coalescent-based approaches that explicitly model the process of incomplete lineage sorting, which may have been prevalent during the rapid radiation of Paenungulata.

  • Combined Nuclear-Mitochondrial Analyses: Developing integrated models that simultaneously analyze nuclear and mitochondrial genes while accounting for their different evolutionary properties and inheritance patterns.

  • Rare Genomic Changes: Supplementing sequence data with analysis of rare genomic changes like retroposon insertions or gene order rearrangements in the mitochondrial genome.

Comparative Rate Analysis:
Understanding how MT-ND4L evolves in different Paenungulate lineages provides crucial context:

  • Lineage-Specific Rate Assessments: Detailed analysis of branch-specific evolutionary rates can identify whether certain lineages (e.g., Sirenia) experienced accelerated evolution of MT-ND4L due to adaptation to marine environments.

  • Detecting Selective Regime Shifts: Using branch-site models to identify shifts in selective pressure that coincided with habitat transitions, such as the move from terrestrial to aquatic environments in Sirenia.

The integration of MT-ND4L sequence data through these sophisticated approaches, while acknowledging its limitations as a single gene, can contribute valuable information to resolving the phylogenetic relationships within Paenungulata. This contributes to our broader understanding of mammalian evolution and the adaptations associated with major habitat transitions.

What cutting-edge techniques can reveal the interaction between MT-ND4L variations and environmental stressors affecting dugong populations?

Understanding how MT-ND4L variations interact with environmental stressors requires integrating cutting-edge molecular techniques with ecological approaches. These advanced methodologies can provide unprecedented insights into mitochondrial adaptation in dugongs facing environmental challenges:

Environmental Genomics and Transcriptomics:

  • Environmental DNA (eDNA) Monitoring: Developing sensitive assays to detect MT-ND4L variants in water samples from dugong habitats, allowing non-invasive population surveillance and variant tracking across geographic regions.

  • Single-Cell Transcriptomics: Applying single-cell RNA sequencing to dugong tissue samples (when available through stranding events) to assess cell-type specific responses to stressors and how MT-ND4L expression patterns vary across tissues and stress conditions.

  • Spatial Transcriptomics: Using spatial mapping of gene expression in tissue sections to identify localized mitochondrial stress responses in various organs affected by environmental contaminants or temperature changes.

Advanced Functional Genomics:

  • CRISPR-Based Mitochondrial Editing: Adapting emerging mitochondrial genome editing technologies to create cellular models with dugong-specific MT-ND4L variants to assess their functional consequences under simulated environmental stress conditions.

  • Protein-Protein Interaction Networks: Using proximity labeling approaches (BioID, APEX) in cellular models to map how MT-ND4L variants alter the interaction landscape of mitochondrial proteins under various stress conditions.

  • Metabolic Flux Analysis: Employing stable isotope labeling to track how MT-ND4L variants affect metabolic pathways and energy production efficiency under conditions mimicking environmental stressors (temperature changes, hypoxia, contaminant exposure).

Integrated Ecological-Molecular Approaches:

  • Eco-Evolutionary Modeling: Developing mathematical models that integrate MT-ND4L variant frequencies with environmental parameters (seagrass availability, water temperature, pollution levels) to predict population responses to changing marine conditions.

  • Seascape Genomics: Correlating spatial patterns of MT-ND4L variants with oceanographic features to identify environmental factors driving selection on mitochondrial genes across the dugong's range.

  • Multi-Species Comparative Approaches: Examining convergent adaptations in MT-ND4L across marine mammals exposed to similar environmental stressors to identify critical adaptive mutations.

Monitoring and Conservation Applications:

TechniqueEnvironmental StressorInformation Provided
Mitochondrial respirometryTemperature variationThermal sensitivity of OXPHOS with different MT-ND4L variants
ROS measurement assaysChemical pollutantsDifferential oxidative stress responses by variant
Stable isotope analysisFood limitationMetabolic efficiency under resource constraints
Epigenetic profilingMultiple stressorsStress-induced regulatory changes affecting MT-ND4L

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.