Recombinant Dumortiera hirsuta Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Dumortiera hirsuta Photosystem Q(B) protein (psbA) is a chloroplast-encoded protein critical to the function of Photosystem II (PSII) in oxygenic photosynthesis. Produced via heterologous expression in E. coli, this recombinant protein corresponds to the full-length psbA gene product (UniProt ID: Q9TNF7) fused to an N-terminal His tag . The D1 protein, encoded by psbA, forms the core of the PSII reaction center, facilitating light-driven water oxidation and electron transport . Its recombinant expression enables detailed structural, functional, and biophysical studies of PSII dynamics, particularly under stress conditions or for biotechnological applications .

Functional Role in Photosystem II

The D1 protein is indispensable for PSII function:

  • Electron Transport: Binds plastoquinone (QB_B), enabling electron transfer from QA_A to the cytochrome b6fb_6f complex .

  • Water Oxidation: Hosts the Mn4_4CaO5_5 cluster, catalyzing water splitting into oxygen and protons .

  • Photoinactivation Repair: Rapidly degraded under high light and replaced via psbA mRNA translation, a process regulated by nuclear-encoded factors .

Studies in cyanobacteria (Synechocystis sp. PCC 6803) demonstrate that plant-derived psbA can integrate into functional PSII complexes despite sequence divergence, though with altered charge recombination kinetics .

Recombinant Expression and Purification

The protein is expressed in E. coli and purified via affinity chromatography (His tag). Critical parameters include:

  • Reconstitution: Requires solubilization in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: Long-term storage at -80°C; avoid repeated freeze-thaw cycles .

  • Yield: >90% purity confirmed by SDS-PAGE and mass spectrometry .

5.1. Photosystem II Biogenesis and Mutagenesis

  • Site-Directed Mutagenesis: Used to study herbicide resistance (e.g., mutations at positions 264, 266 in Chlamydomonas reinhardtii D1 alter binding to QB_B-site inhibitors like DCMU) .

  • Chimeric PSII Complexes: Plant psbA expressed in cyanobacteria retains water oxidation activity, enabling evolutionary studies .

5.2. Photoinactivation and Repair Mechanisms

  • Accelerated charge recombination (QB_B^-/S2_2 states) under light stress correlates with D1 degradation rates .

  • Sentinel D1 isoforms in nitrogen-fixing cyanobacteria (Cyanothece sp.) lack Mn-binding ligands, blocking water oxidation during nitrogenase activity .

Comparative Analysis with Orthologs

SpeciesKey FeaturesUniProt ID
Prorocentrum micans343-aa D1 protein; 85% sequence identity with D. hirsuta; similar QB_B-binding nicheQ9TM72
Cyanothece sp. ATCC 51142Sentinel D1 (c-psbA4) lacks Mn-cluster ligands, enabling temporal PSII inactivationN/A

Challenges in Handling and Stability

  • Instability: Degrades rapidly if improperly stored; glycerol (50%) is recommended for aliquots .

  • Reconstitution: Requires precise buffer conditions (Tris/PBS, pH 8.0) to maintain solubility .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Dumortiera hirsuta (Liverwort)
Target Names
psbA
Target Protein Sequence
MTATLERRESASIWGRFCNWVTSTENRLNIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEQETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what protein does it encode?

The psbA gene encodes the Photosystem II protein D1 (also known as PSII D1 protein or Photosystem II Q(B) protein), a crucial component of the photosynthetic apparatus. In Dumortiera hirsuta, this gene produces a 344-amino acid protein with a molecular structure adapted to its ecological niche . The full-length protein (Q9TNF7) can be expressed recombinantly with fusion tags for research purposes. The psbA gene in photosynthetic organisms shows no introns, as confirmed through DNA and cDNA sequence comparisons in related species .

How does the D1 protein function within Photosystem II?

The D1 protein forms the core of Photosystem II reaction center, where it plays an essential role in electron transport during photosynthesis. It contains binding sites for numerous cofactors including the manganese cluster responsible for water oxidation. In the context of herbicide interactions, specific amino acid residues within D1 (such as positions 264 and 274) form critical binding pockets that interact with various PSII-inhibiting herbicides . The D1 protein undergoes a complex lifecycle that includes assembly, damage, and repair phases. During assembly, it interacts with numerous auxiliary proteins like Psb27, which helps prevent premature activation and damage to developing PSII complexes .

What expression systems are optimal for recombinant production of Dumortiera hirsuta psbA?

E. coli remains the preferred expression system for recombinant production of Dumortiera hirsuta psbA protein. The protein can be successfully expressed as a full-length construct (1-344 amino acids) with an N-terminal His tag to facilitate purification . When expressing membrane proteins like psbA, researchers should optimize growth conditions including temperature (typically lowered to 18-25°C after induction), inducer concentration, and incubation time to maximize proper folding and minimize inclusion body formation. For functional studies, expression in cyanobacterial systems may be considered as they provide a more native-like environment for photosynthetic proteins, though with lower yields than E. coli.

What purification strategies yield the highest purity recombinant psbA protein?

Purification of His-tagged psbA protein typically employs immobilized metal affinity chromatography (IMAC) as the primary capture step. A recommended purification protocol includes:

  • Cell lysis using mild detergents to solubilize membrane-associated proteins

  • IMAC purification using Ni-NTA or similar resin

  • Size exclusion chromatography to remove aggregates and improve homogeneity

  • Optional ion exchange chromatography for removing remaining impurities

Final purity should exceed 90% as determined by SDS-PAGE . For maintaining protein stability, purification buffers often contain glycerol (5-50%) and are maintained at pH 8.0. The protein is typically stored as a lyophilized powder or in solution with added stabilizers .

What are the critical storage conditions for maintaining psbA protein stability?

Recombinant psbA protein stability is highly dependent on proper storage conditions. The recommended practices include:

Storage FormConditionsDurationNotes
Lyophilized powder-20°C to -80°CLong-termPrimary storage form
Reconstituted4°CUp to one weekWorking aliquots
Aliquoted with glycerol-20°C to -80°CMedium-term6% Trehalose in Tris/PBS buffer, pH 8.0

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided . When reconstituting the protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (with 50% being optimal) before aliquoting and freezing is recommended .

How do specific mutations in the psbA gene affect herbicide binding and resistance?

Mutations in the psbA gene can significantly alter herbicide binding properties of the D1 protein. Two well-characterized mutations include:

  • Ser264-Gly: This classic mutation confers high resistance to triazine herbicides like atrazine. It alters the herbicide binding pocket, reducing atrazine binding affinity while simultaneously increasing sensitivity to other herbicides like bromoxynil .

  • Phe274-Val: This novel mutation, identified in wild radish (Raphanus species), confers moderate resistance to triazine herbicides and diuron. 3D modeling demonstrates that this mutation indirectly affects herbicide binding by altering the protein's tertiary structure .

These mutations highlight how specific amino acid changes can substantially alter ligand-protein interactions, providing valuable insights for both agricultural applications and fundamental research on protein-ligand interactions.

How can structural modeling help understand psbA mutations and herbicide interactions?

Structural modeling provides crucial insights into how mutations affect herbicide binding. For example, 3D modeling of the D1 protein in wild radish revealed:

  • In wild-type D1, atrazine forms hydrogen bonds with specific residues creating a stable binding pocket

  • The Ser264-Gly mutation disrupts hydrogen bonding with atrazine, reducing its binding affinity

  • The Phe274-Val mutation indirectly affects the binding pocket structure, altering binding characteristics for different herbicides

For researchers, combining site-directed mutagenesis with structural modeling provides a powerful approach to understanding structure-function relationships. This methodology involves generating mutant proteins, determining their herbicide binding properties experimentally, and correlating these with predicted structural changes from computational models .

What experimental approaches can quantify the functional impacts of psbA mutations?

Quantifying the functional impacts of psbA mutations typically involves several complementary approaches:

  • Herbicide dose-response assays: By exposing wild-type and mutant plants to increasing concentrations of herbicides, researchers can determine LD50 values and calculate resistance ratios. For example, the Phe274-Val mutation in wild radish showed a 5.8-fold resistance to diuron compared to susceptible plants .

  • Chlorophyll fluorescence measurements: These non-invasive techniques assess photosynthetic electron transport efficiency. Parameters like maximum PSII quantum yield and non-photochemical quenching can quantify how mutations affect photosystem function under various light conditions .

  • Multiple flash-induced fluorescence decay analysis: This technique evaluates electron transfer from QA to QB, providing insights into how mutations affect electron transport within PSII .

What is Dumortiera hirsuta and what ecological niches does it occupy?

Dumortiera hirsuta (Sw.) Nees is a liverwort species with a distinctive thallus morphology (8-30 mm wide, flat, deep green, not tinged with purple). It exhibits dichotomous and apical branching patterns. Key morphological features include:

  • Epidermal pores that are either absent or present only at the thallus apex

  • Air chambers that are absent or vestigial, arranged in a single layer

  • Bristles present on the ventral thallus side and on gametangiophores

  • Ventral scales arranged in two rows, small, hyaline, without oil cells

This species has a remarkably wide geographical distribution, occurring in tropical and warm-temperate regions globally, including Western Europe, the Mediterranean, Macaronesia, Africa, the Mascarenes, Asia, Oceania, New Zealand, and the Americas. In the United States, it has been documented in 19 states . This broad distribution suggests adaptability to various environmental conditions, likely facilitated by physiological adaptations in its photosynthetic apparatus.

How can Psb27-psbA interactions inform our understanding of photosystem assembly and protection?

Research on Psb27, a photosystem II assembly protein, provides valuable insights into PSII lifecycle and protection mechanisms that may be relevant to understanding psbA function in Dumortiera hirsuta. Studies with cyanobacterial Psb27 mutants revealed:

  • Psb27 associates with the CP43 chlorophyll-binding subunit of PSII, forming a complex that constitutes 7-10% of the total PSII pool.

  • Psb27 deletion mutants showed decreased non-photochemical fluorescence quenching, whereas Psb27 overexpression mutants exhibited increased non-photochemical quenching and improved tolerance to fluctuating light conditions.

  • The association between Psb27 and CP43, coupled with the absence of a fully functional manganese cluster in the Psb27-PSII complex, creates a PSII sub-population that effectively dissipates excitation energy before recruitment into the functional PSII pool .

These findings suggest that PSII assembly proteins like Psb27 play crucial roles beyond mere structural assembly, contributing to photoprotection during the vulnerable assembly phase. For researchers working with recombinant Dumortiera hirsuta psbA, considering these protein-protein interactions could be vital for functional studies.

What methodologies are effective for studying herbicide resistance mechanisms in psbA mutants?

Investigation of herbicide resistance mechanisms in psbA mutants benefits from an integrated approach combining multiple methodologies:

  • Sequencing and genetic analysis: Full-length psbA gene sequencing from resistant and susceptible populations to identify mutations. This can be performed using PCR amplification followed by sequencing, as demonstrated in wild radish studies that identified the novel Phe274-Val mutation .

  • Dose-response experiments: Precise quantification of resistance levels through structured experiments:

ComponentMethodology
Experimental designRandomized complete block with three replicates per treatment
Herbicide applicationGraduated doses (e.g., 0, 31, 62, 125, 187, 250, 375, 500 g ha⁻¹ for atrazine)
AssessmentVisual damage ratings and determination of LD₅₀ values
AnalysisCalculation of resistance ratios (R/S) to quantify resistance levels
  • Structural modeling: 3D-modeling of D1 protein variants to visualize how mutations affect protein-herbicide interactions. This approach revealed how the Phe274-Val mutation alters the binding of atrazine, diuron, metribuzin, and bromoxynil to the D1 protein .

  • Functional assays: Measurements of photosynthetic parameters using chlorophyll fluorescence techniques to assess the impact of mutations on PSII function beyond herbicide resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.