Recombinant Dunaliella tertiolecta Chlorophyll a-b binding protein of LHCII type I, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance (additional charges apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To prioritize a specific tag, please indicate your preference.
Synonyms
Chlorophyll a-b binding protein of LHCII type I, chloroplastic; CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-253
Protein Length
full length protein
Species
Dunaliella tertiolecta (Green alga)
Target Protein Sequence
VEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWA LLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQ VVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMF SCLGFFVQAIVTGKGPVQNLTDHLADPTVNKAFASATKFTPGV
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems and purification methods are recommended for this recombinant protein?

For optimal expression of Recombinant Dunaliella tertiolecta Chlorophyll a-b binding protein:

Expression SystemDetails
HostE. coli (primary), alternatives include yeast, baculovirus, or mammalian cell systems
Vector ConstructionHis-tagged N-terminal fusion is commonly employed
Expression RegionFull length (amino acids 31-253)
PurificationSDS-PAGE with purity threshold >90%
StorageStore at -20°C/-80°C in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (with 50% as the default final concentration) is advised for long-term storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How does Dunaliella tertiolecta adapt to environmental stresses, and what role might the Chlorophyll a-b binding protein play?

D. tertiolecta demonstrates remarkable adaptability to environmental stresses including high light intensity, nitrogen deficiency, and high salinity.

Research methods to study these adaptations include:

  • Light stress adaptation: D. tertiolecta exhibits photoacclimation under fluctuating irradiance regimes that simulate mixed layer conditions of turbid estuarine waters. When exposed to fluctuating light conditions, the algae maintain division rates comparable to cells grown at high irradiance, but interestingly, they display photoacclimation characteristics consistent with cells grown under stable regimes at significantly lower irradiances than the average of the simulated mixed layer .

  • Transcriptomic profiling: Transcriptome meta-analysis has revealed substantial changes in expression patterns under various stress conditions. Using RNA-seq experiments, researchers have identified key metabolite biosynthesis pathways that respond to environmental stresses .

The Chlorophyll a-b binding protein likely plays a crucial role in these adaptations by modifying the light harvesting apparatus to optimize photosynthetic efficiency under variable conditions, though the exact regulatory mechanisms are still being elucidated through protein-protein interaction network analyses .

What methodologies are most effective for studying photoacclimation in Dunaliella tertiolecta, and how does the Chlorophyll a-b binding protein respond to different light regimes?

For comprehensive analysis of photoacclimation in D. tertiolecta, researchers should employ a multi-parameter approach:

Experimental Design Methodology:
The most effective approaches utilize high-throughput light simulations with precise control over irradiance parameters. A structured experimental design should include:

  • Fixed irradiance regimes to establish baseline physiology-irradiance relationships

  • Simulated mixed layer conditions with fluctuating light to mimic natural environments

  • Multiple measurable indices of photoacclimation including:

    • Cellular pigmentation

    • Chlorophyll variable fluorescence

    • Effective photosystem II antenna size

A factorial design with three levels for each experimental factor has proven effective, allowing researchers to model up to 32 strains in triplicate in a single experiment .

Key Findings on Chlorophyll a-b Binding Protein Response:
Studies have shown that under fluctuating light conditions, D. tertiolecta maintains growth rates comparable to cells under high irradiance but exhibits photoacclimation characteristics typical of lower light environments. This suggests a sophisticated acclimation strategy involving the light-harvesting apparatus, of which the Chlorophyll a-b binding protein is a key component .

The protein's differential expression under varying light conditions indicates its role in optimizing light capture efficiency, particularly when cells must rapidly adapt to changing irradiance levels—a common situation in natural aquatic environments where turbulent motion transports phytoplankton across light gradients .

What is known about iron regulation in Dunaliella species, and how does iron limitation affect the expression of Chlorophyll a-b binding proteins?

Iron regulation in Dunaliella species involves sophisticated adaptive mechanisms that have evolved to manage Fe quota effectively, particularly in iron-limited environments.

Iron Limitation Response Mechanisms:

Recent multi-omics analysis of Dunaliella species has revealed multiple complementary strategies for iron uptake and management:

  • Replacement of ferredoxin by flavodoxin - This substitution reduces the Fe quota by approximately 6%, representing a significant adaptation to iron limitation .

  • Expansion of Transferrin family proteins - Both D. tertiolecta and D. salina Bardawil exhibit an expansion of Transferrin-encoding genes (seven in D. tertiolecta and six in D. salina Bardawil), which are dramatically upregulated under low iron conditions .

  • SUPT protein family expression - A family of proteins named SUPT (siderophore uptake proteins) shows strong upregulation in response to iron limitation, suggesting their role in siderophore-Fe uptake mechanisms .

Impact on Chlorophyll a-b Binding Proteins:

In the related species Dunaliella salina, iron deprivation induces a major 45-kDa chloroplast protein termed Tidi, which shares high amino acid sequence similarity with light-harvesting I chlorophyll a/b-binding proteins from higher plants but features an extended proline-rich N-terminal domain. Research findings indicate:

  • Tidi accumulation is inversely correlated with photosystem I reaction center proteins

  • In native gel electrophoresis, Tidi co-migrates with enlarged PS-I-LHC-I super-complexes

  • Single particle electron microscopy analysis shows that PS-I units from iron-deficient cells are significantly larger (31 and 37 nm in diameter) than PS-I units from control cells (22 nm)

  • The 77 K chlorophyll fluorescence emission spectra suggest that Tidi-LHC-I antenna complexes are functionally coupled to PS-I reaction centers

These findings suggest that Tidi acts as an accessory antenna of PS-I, and the enlargement of PS-I antenna in both algae and cyanobacteria under iron deprivation indicates a common limitation that requires rebalancing of energy distribution between the two photosystems .

This adaptation represents a sophisticated response to iron limitation, allowing the photosynthetic apparatus to maintain function despite reduced iron availability.

How can genetic engineering approaches utilizing the Dunaliella tertiolecta Chlorophyll a-b binding protein improve photosynthetic efficiency in microalgae?

Genetic engineering approaches targeting the D. tertiolecta Chlorophyll a-b binding protein offer promising avenues for enhancing photosynthetic efficiency in microalgae. Multiple strategies have demonstrated potential:

Light-Harvesting Complex Engineering:

Research has shown that modifying light-harvesting antenna complexes can significantly impact photosynthetic efficiency. Key approaches include:

  • RNA interference (RNAi) and artificial microRNA (amiRNA) silencing of specific light-harvesting complex genes. For example, silencing of Lhcb genes in the related Chlamydomonas reinhardtii has yielded valuable insights that can be applied to D. tertiolecta:

    • Silencing of Lhcbm2+7 resulted in decreased abundance of trimeric LHCII bands

    • Silencing of both LHCBM1 and LHCBM2+8 effectively decreased the functional antenna size of PSII

  • Mutant selection for optimized growth in different optical environments:

    • Researchers have successfully tested mutants in small-scale photobioreactors (400 ml) and in systems that artificially recreate the shading effect of different layers in large-scale photobioreactors

  • Non-photochemical quenching (NPQ) modification:

    • Studies have established a strict relationship between NPQ and productivity, demonstrating that NPQ and LhcSR3 (a protein related to light-harvesting complexes) are key elements in biomass production

    • The npq4 mutant showed 22% higher light use efficiency and productivity compared to wild type at 200 μmol m-2s-1 under light/dark cycles of 1s

Complementary Carbon Fixation Enhancement:

In addition to light-harvesting modifications, enhancing carbon fixation enzymes can complement improvements to the light reactions:

  • Sedoheptulose-1,7-bisphosphatase (SBPase) overexpression:

    • A synthetic codon-optimized SBPase gene from D. tertiolecta has been constructed for expression in the chloroplast of Chlamydomonas, suggesting similar approaches could be effective in D. tertiolecta itself

  • Vector construction for controlled expression:

    • Several vectors have been developed for both silencing and overexpression of key enzymes, providing tools for manipulating D. tertiolecta's photosynthetic apparatus

These approaches, when combined, offer potential for developing D. tertiolecta strains with enhanced photosynthetic efficiency, ultimately leading to increased biomass production and improved carbon sequestration capabilities.

What are the most effective analytical techniques for characterizing the structure-function relationship of the Chlorophyll a-b binding protein in Dunaliella tertiolecta?

Comprehensive characterization of structure-function relationships in the D. tertiolecta Chlorophyll a-b binding protein requires a multi-technique approach:

Structural Analysis Techniques:

TechniqueApplicationResolutionAdvantages
X-ray CrystallographyDetermine atomic structureAtomic level (1-3Å)High resolution of protein-pigment interactions
Cryo-Electron MicroscopyVisualize supercomplexesNear-atomic (3-4Å)Preserves native state of complexes
Native Gel ElectrophoresisAnalyze complex formationProtein complex levelIdentifies protein-protein interactions
Single Particle EM AnalysisStudy PS-I units22-37 nm diameter structuresReveals size differences under varying conditions

Functional Analysis Techniques:

  • Spectroscopic Methods:

    • Absorption and fluorescence excitation spectra to analyze pigment-protein interactions

    • 77K chlorophyll fluorescence emission spectra to determine functional coupling of antenna complexes to reaction centers

    • Chlorophyll variable fluorescence measurements to assess photosystem II efficiency

  • Time-Resolved Fluorescence Analysis:

    • Video-imaging devices coupled with spectrophotometer-fluorimeter systems

    • Fast digital cameras with wide-angle lenses for analysis of samples up to 10 x 10 cm

    • These setups allow measurement of time-resolved chlorophyll fluorescence in response to light

  • Proteomics Approaches:

    • Quantitative proteomics using differential 15N/14N metabolic labeling

    • Analysis of the light-harvesting complex under different conditions

    • Identification of protein-protein interactions within the photosynthetic apparatus

The most effective research employs these techniques in combination to establish correlations between structural features and functional properties. For example, studies on the related iron-deficiency-induced Tidi protein in D. salina demonstrated that single particle electron microscopy analysis of PS-I units, combined with 77K chlorophyll fluorescence emission spectra and native gel electrophoresis, revealed how structural changes in PS-I units correlate with functional adaptations to iron limitation .

How does transcriptome analysis reveal the role of Chlorophyll a-b binding protein in metabolic pathway regulation under stress conditions in Dunaliella tertiolecta?

Transcriptome analysis has emerged as a powerful approach to understand the regulatory networks involving Chlorophyll a-b binding proteins in D. tertiolecta under stress conditions.

Methodological Approach:

  • RNA-seq Meta-analysis Framework:

    • Integration of multiple RNA-seq experiments examining D. tertiolecta responses to high light, nitrogen deficiency, and high salinity stress conditions

    • Identification of differentially expressed genes (DEGs) across multiple stress conditions

    • Construction of protein-protein interaction (PPI) network analysis to extend possible functions of identified meta-genes

  • Resolution of Contradictory Findings:
    Transcriptome meta-analysis has helped resolve contradictions in previous literature. For example:

    • Some studies reported increased Glycerol-3-phosphate dehydrogenase (GPDH-c) transcription levels under salinity stress, while others showed decreased expression

    • Different studies reported varying degrees of FBPA expression under abiotic conditions

    • Not all Dunaliella species respond similarly to abiotic stress conditions

Key Findings on Metabolic Pathway Regulation:

Transcriptome studies have revealed that chlorophyll-binding proteins are integrated into broader metabolic networks that respond to environmental stresses:

  • Light Stress Response Network:

    • Chlorophyll a-b binding proteins show differential expression under high light conditions, participating in photoacclimation mechanisms

    • These changes correlate with modifications in carbon assimilation and photoprotection pathways

  • Integration with Carbon Metabolism:

    • Stress conditions induce coordinated changes in both light-harvesting complexes and carbon-fixing enzymes

    • This coordination suggests regulatory crosstalk between light reactions and carbon metabolism

  • Species-Specific Responses:

    • D. tertiolecta exhibits distinct transcriptional profiles under stress compared to other Dunaliella species

    • These differences may explain D. tertiolecta's unique adaptability to various environmental conditions

The application of transcriptome meta-analysis has been particularly valuable in identifying potentially contradictory findings in the literature and establishing more robust models of gene expression changes under stress conditions. This approach provides a comprehensive view of how Chlorophyll a-b binding proteins participate in the cellular response to environmental challenges.

What are the optimal experimental designs for studying photosynthetic efficiency in Dunaliella tertiolecta under variable light conditions, and how does the LHCII type I protein contribute?

Designing optimal experiments for studying photosynthetic efficiency in D. tertiolecta requires careful attention to both environmental simulation and measurement techniques:

Advanced Experimental Design Framework:

  • High-Throughput Light Simulation Systems:

    • Design should incorporate precise control over light intensity, duration, and fluctuation patterns

    • A three-level factorial design allows testing of multiple variables (intensity, cycle frequency, nutrient levels)

    • Comparative testing between constant and fluctuating light regimes is essential

  • Simulation of Natural Conditions:

    • Experiments should simulate turbid estuarine waters or lakes with vertical mixing

    • Establish baseline physiology-irradiance relationships under fixed conditions before testing fluctuating regimes

    • Compare division rates and photoacclimation characteristics between stable and fluctuating regimes

Measurement Parameters and Techniques:

Contribution of LHCII Type I Protein:

The Chlorophyll a-b binding protein of LHCII type I plays a central role in photoacclimation strategies:

  • Under fluctuating light conditions, D. tertiolecta maintains division rates comparable to high-light grown cells but exhibits photoacclimation characteristics consistent with lower light environments

  • This suggests that the LHCII proteins, including the Chlorophyll a-b binding protein of LHCII type I, undergo dynamic regulation to optimize light harvesting under variable conditions

  • These proteins likely participate in both short-term (minutes to hours) and long-term (days) acclimation strategies, with different regulatory mechanisms operating at different timescales

Research has shown that when D. tertiolecta is exposed to a range of fixed irradiance regimes and then compared with subsequent photoacclimation to a simulated mixed layer, the cells maintain high division rates while adjusting their photosynthetic apparatus to optimize efficiency under the variable conditions .

How can the recombinant Dunaliella tertiolecta Chlorophyll a-b binding protein be utilized in comparative studies across different algal species to understand evolutionary adaptations to extreme environments?

The recombinant D. tertiolecta Chlorophyll a-b binding protein offers a valuable tool for comparative evolutionary studies, particularly in understanding adaptations to extreme environments:

Methodological Framework for Comparative Studies:

  • Multi-Species Protein Structure-Function Analysis:

    • Compare the amino acid sequence and structure of Chlorophyll a-b binding proteins across species from various environments

    • Examine conservation of key functional domains versus adaptive variations

    • Correlate structural differences with habitat-specific adaptations

  • Evolutionary Genomics Approach:

    • Utilize chromosome-complete assemblies (as developed for D. salina Bardawil) and near chromosome-complete assemblies (as for D. tertiolecta)

    • Compare with genomes of mesophilic chlorophycean algae to identify genomic adaptations

    • Determine divergence dates between species (e.g., D. salina and D. tertiolecta estimated to have diverged ~253 million years ago)

  • Comparative Transcriptomics Under Stress:

    • Subject multiple species to identical stress conditions (iron limitation, high light, nitrogen deficiency, salinity)

    • Compare differential gene expression patterns across species

    • Identify conserved versus species-specific stress responses

Key Research Findings on Evolutionary Adaptations:

  • Genomic Adaptations in Extremophiles:

    • Dunaliella genomes are exceptionally large relative to other mesophilic chlorophycean algae

    • Their size is attributed to being rich in transposable elements and repetitive sequences, and having very large introns

    • The more extremophilic species, D. salina Bardawil, has a significantly larger genome, more protein-coding genes, more transposable elements, and more gene duplications than D. tertiolecta

  • Iron Adaptation Mechanisms:

    • Dunaliella species have evolved multiple strategies for iron uptake and management

    • These include a major expansion of Transferrin family proteins, with 7 in D. tertiolecta and 6 in D. salina Bardawil

    • Another adaptation is the replacement of ferredoxin by flavodoxin, reducing the Fe quota by approximately 6%

  • Photoacclimation Differences:

    • Comparative studies reveal species-specific differences in photoacclimation strategies

    • D. tertiolecta shows distinctive photoacclimation under fluctuating irradiance compared to other algal species

    • These differences reflect evolutionary adaptations to specialized ecological niches

Using the recombinant D. tertiolecta Chlorophyll a-b binding protein as a reference point, researchers can conduct detailed comparative studies to understand how this critical photosynthetic component has evolved across species adapted to different environments. This approach provides insights into both the conserved core functions of photosynthesis and the diverse adaptative strategies that have evolved in response to environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.