Recombinant Duvenhage virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Background on Duvenhage Virus

Duvenhage virus is a rare but highly pathogenic virus primarily found in Africa. It is known for causing severe neurological symptoms in humans, with only a few documented cases worldwide . The virus's glycoprotein G is essential for viral attachment and entry into host cells, making it a key antigen for immune recognition and response.

Structure and Function of Glycoprotein G

Glycoprotein G of the Duvenhage virus is a transmembrane protein responsible for mediating viral attachment to host cells and facilitating viral entry. It is the primary antigen recognized by the host immune system, eliciting both humoral and cellular immune responses .

Recombinant Glycoprotein G in Vaccine Development

Recombinant technology allows for the expression of the Duvenhage virus glycoprotein G in various systems, such as bacterial or mammalian cells, to produce large quantities of this protein for vaccine development. This approach aims to induce protective immunity by stimulating the production of neutralizing antibodies against the glycoprotein G .

Table 1: Characteristics of Duvenhage Virus Glycoprotein G

CharacteristicDescription
FunctionMediates viral attachment and entry into host cells.
ImmunogenicityElicits both humoral and cellular immune responses.
Expression SystemsCan be expressed in bacterial or mammalian cells.
Vaccine PotentialUsed to induce protective immunity against Duvenhage virus.

Immunoinformatics and In Silico Modeling

Immunoinformatics tools are used to predict epitopes within the glycoprotein G that can bind to major histocompatibility complex (MHC) molecules, facilitating the design of peptide-based vaccines. These predictions help identify conserved regions of the glycoprotein that are likely to induce broad immune protection .

Table 2: Predicted Epitopes and Their Binding Affinity

Epitope SequenceStart-End PositionLengthEmini ScoreAntigenicity Score
YTIPDKLGPWSPI24-36130.6141.03
YTIPDKL24-3071.1561.047
LVVEDEGCTTL47-57110.1311.085
VVTEAETYT83-9190.813-

Table 3: Genetic Variability of Duvenhage Virus Glycoprotein G

IsolateGenetic Identity (%)Geographic Origin
DUVV-NL0795% with other DUVV isolatesNetherlands
South African IsolatesUp to 99% among themselvesSouth Africa

Future Directions

Future research should focus on developing a pan-lyssavirus vaccine that can protect against multiple strains, including Duvenhage virus. This could involve using recombinant glycoprotein G from different lyssaviruses to stimulate cross-protective immunity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-533
Protein Length
Full Length of Mature Protein
Species
Duvenhage virus (DUVV)
Target Names
G
Target Protein Sequence
KFPFYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTTLTPFSYMELKVGYITSIKVSGFT CTGVVTEAETYTNFVGYVTTTFRRRHFRPSVNSCRDAYNWKIAGDPRYEESLHNPYPDSH WLRTVKTTKESLLIISPSVADMDAYDKKLYSKIVSNGRCSEISPGSPFCPTNHEYTIWMP ESSNPGISCDIFTRSMGKKATKDGQLCGFVDERGLYKSLKGACRLRLCGISGLRLMDGSW VSLPQVNNSEWCSPDQLVNIHDFHSDEIEHLVADELVKKREDCLDALETILFTKSISFRR LSHLRKLVPGFGKAYTIINRTLMEAEAHYKSVREWKEIIPSKGCLKAGGRCYPHHNGIFF NGIILGPGGEILIPEMQSALLQQHIELLESSVVPLKHPLADPSTVFKNDDEAESFVDVHL PDTNQKISGIDLGLPEWKRYFLIGVSAVALLALSIIIAVCCKRFRKRKKSKPGPVELTRK VSVISKGNGPVPSWESYKEGTTGDVRNTTPSTRE
Uniprot No.

Target Background

Function

Recombinant Duvenhage virus Glycoprotein G (G) mediates viral attachment to the host cell receptor, triggering virion endocytosis. The ensuing acidic pH within the endosome induces conformational changes in the glycoprotein trimer, ultimately initiating fusion between the viral and cellular membranes.

Protein Families
Lyssavirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

Basic Research Questions

  • What is Duvenhage virus and how does it relate to other lyssaviruses?

    Duvenhage virus (DUVV) belongs to the genus Lyssavirus within the family Rhabdoviridae. It is classified as genotype 4 in the lyssavirus taxonomy, alongside rabies virus (genotype 1), Lagos bat virus (genotype 2), Mokola virus (genotype 3), European bat lyssaviruses 1 and 2 (genotypes 5 and 6), and Australian bat lyssavirus (genotype 7). Phylogenetic analysis places DUVV in phylogroup I along with rabies virus, European bat lyssaviruses, and Australian bat lyssavirus . Within this phylogroup, the glycoprotein ectodomain shares at least 74% amino acid identity and displays significant cross-neutralization properties. DUVV has caused documented human infections following bat exposures, with two known cases in South Africa separated by 36 years and approximately 80 km geographically .

  • What is the structure and function of Duvenhage virus Glycoprotein G?

    Duvenhage virus Glycoprotein G is a membrane protein that forms spikes on the viral surface. It serves three critical functions: (1) binding to host cell receptors to facilitate viral entry, (2) mediating membrane fusion during viral entry, and (3) acting as the primary antigenic determinant recognized by virus-neutralizing antibodies . The glycoprotein undergoes post-translational modifications, particularly glycosylation, which influences its proper folding, trafficking through the endoplasmic reticulum and Golgi apparatus, and antigenic properties . Like other lyssavirus glycoproteins, DUVV G contains important antigenic sites that induce neutralizing antibodies and T-cell responses, making it the major target for vaccine development .

  • How do specific amino acid residues in Duvenhage virus Glycoprotein G affect its pathogenicity?

    Specific amino acid residues in DUVV G play crucial roles in determining pathogenicity. Most notably, position 333 is critical for lyssavirus virulence. In phylogroup I viruses including DUVV, an arginine (R333) is essential for neuroinvasiveness and neurovirulence. Research has demonstrated that phylogroup II viruses (Mokola and Lagos bat viruses) naturally have aspartic acid (D333) at this position, which results in attenuated pathogenicity . This difference in amino acid explains why phylogroup I viruses are pathogenic when injected by both intracerebral and intramuscular routes, whereas phylogroup II viruses are only pathogenic via the intracerebral route . Additionally, by analogy with rabies virus, other positions such as amino acid 8 may affect protein conformation and function. Studies with vaccinia-rabies recombinants showed that a proline rather than leucine at position 8 was critical for effective immunization .

  • What glycosylation patterns are observed in Duvenhage virus Glycoprotein G?

    Glycosylation is crucial for proper folding, trafficking, and antigenic properties of lyssavirus glycoproteins. DUVV G contains specific N-glycosylation sites that influence its structure and function. Research has identified a potential N-glycosylation site at position 247 that appears to be specific to Duvenhage virus . This differs from other lyssaviruses, which have unique glycosylation patterns - Mokola virus contains a site at position 202, while Lagos bat virus has potential sites at positions 184, 202, and 334 . The minimal glycosylation site sufficient for adequate maturation and routing through the endoplasmic reticulum and Golgi apparatus appears to be located in the G ectodomain of bat lyssaviruses, including DUVV . These differences in glycosylation patterns contribute to the distinct antigenic properties of each lyssavirus and affect their recognition by the immune system.

Methodological Questions

  • What techniques are most effective for detecting immune responses to recombinant Duvenhage virus Glycoprotein G?

    Several complementary techniques are used to comprehensively assess immune responses to DUVV G:

    For antibody responses:

    • Virus neutralization assays: The gold standard for measuring functional antibodies that can neutralize virus infectivity. This can be performed with live DUVV or pseudotyped viruses expressing DUVV G .

    • ELISA: Quantifies antibody binding to recombinant G protein or specific epitopes.

    • Immunofluorescence assays: Detect antibodies that bind to G protein expressed on infected cells .

    • Western blotting: Identifies antibodies recognizing linear epitopes on denatured G protein.

    For cellular immune responses:

    • ELISpot assays: Enumerate antigen-specific cytokine-producing T cells.

    • Intracellular cytokine staining: Measure T-cell activation via flow cytometry.

    • Cytotoxic T-lymphocyte (CTL) assays: Assess the ability of CD8+ T cells to kill infected target cells. Studies with recombinant vaccinia-rabies G viruses have shown they effectively prime mice to generate secondary virus-specific CTL responses .

    • Lymphocyte proliferation assays: Measure T-cell proliferation in response to antigen stimulation.

    These methods allow researchers to characterize both humoral (antibody) and cellular immune responses, which are both important for protection against lyssavirus infections.

  • How can animal models be used to evaluate the efficacy of vaccines based on recombinant Duvenhage virus Glycoprotein G?

    Animal models are crucial for evaluating vaccine efficacy before human trials. For DUVV G-based vaccines, several approaches can be used:

    Mouse models:

    • Challenge studies: Immunized mice are challenged with virulent DUVV via intracerebral or peripheral routes to assess protection. Survival rates and clinical scores are primary endpoints .

    • Dose-response studies: Determine minimum protective doses - studies with vaccinia-rabies glycoprotein recombinants found that 10^4 plaque-forming units were required for effective immunization .

    • Cross-protection studies: Test protection against other lyssaviruses to assess breadth of immunity. Vaccinia-rabies glycoprotein recombinants have shown protection against not only rabies virus but also Duvenhage virus, though not against Mokola virus .

    Critical parameters to measure:

    • Neutralizing antibody titers: Strong correlate of protection against lyssavirus infection.

    • T-cell responses: Both CD4+ and CD8+ T-cell responses contribute to protection.

    • Duration of immunity: Long-term protection is essential for effective vaccines.

    • Safety parameters: Weight loss, local reactions, systemic adverse events.

    Special considerations:

    • Both live and inactivated preparations should be evaluated - β-propiolactone-inactivated preparations of vaccinia-rabies recombinants have successfully induced neutralizing antibodies and protection .

    • Multiple challenge strains should be tested to ensure broad protection, as demonstrated in studies showing protection against several strains of rabies virus .

  • What molecular techniques can be used to study the interactions between Duvenhage virus Glycoprotein G and host cell receptors?

    Understanding G protein-receptor interactions requires sophisticated molecular approaches:

    Receptor identification methods:

    • Co-immunoprecipitation with crosslinking to capture transient interactions

    • CRISPR-Cas9 screening to identify host factors essential for viral entry

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to G during entry

    • RNA interference screening to identify host factors required for viral entry

    Binding affinity measurements:

    • Surface plasmon resonance (SPR) to measure real-time binding kinetics

    • Bio-layer interferometry (BLI) for label-free detection of biomolecular interactions

    • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of binding

    Structural characterization:

    • X-ray crystallography of G protein-receptor complexes to determine atomic structure

    • Cryo-electron microscopy for structural analysis of larger complexes

    • Computational modeling and molecular dynamics simulations to predict interactions

    Functional assays:

    • Cell-cell fusion assays to assess fusion activity mediated by G protein

    • Pseudotyped virus entry assays using viruses bearing DUVV G

    • Site-directed mutagenesis to identify critical binding residues

    • Competition assays with peptides or antibodies to block specific interactions

    These approaches would help identify whether DUVV G interacts with known lyssavirus receptors (nicotinic acetylcholine receptor, neural cell adhesion molecule, or p75 neurotrophin receptor) or utilizes unique receptors for cell entry.

  • How can immunoinformatics approaches be used to design effective vaccines against Duvenhage virus?

    Immunoinformatics combines computational tools and immunological knowledge to accelerate vaccine design:

    Epitope prediction:

    • B-cell epitope prediction: Algorithms analyze protein sequences for properties associated with antibody recognition (hydrophilicity, accessibility, flexibility)

    • T-cell epitope prediction: Tools like those in the Immune Epitope Database (IEDB) predict peptide binding to MHC molecules

    • Conserved epitope identification: Comparing sequences across lyssavirus strains to identify invariant regions

    Population coverage analysis:

    • HLA allele frequency data is used to predict what percentage of a population might respond to specific epitopes

    • Research on DUVV G identified the epitope "YFLIGVSAV" with binding to 18 alleles and 99.36% worldwide population coverage

    Vaccine design strategies:

    • Multi-epitope vaccines combining B-cell and T-cell epitopes

    • Consensus sequence approaches to address viral variation

    • Structure-based design focusing on exposing neutralizing epitopes

    In silico validation:

    • Molecular dynamics simulations to assess epitope stability

    • Docking studies to predict epitope-antibody or epitope-MHC interactions

    • Homology modeling of epitope-MHC complexes

    Studies have successfully applied these approaches to DUVV G, identifying promising epitopes for peptide vaccine development with predicted high immunogenicity and low allergenicity . These computational predictions require experimental validation but can significantly accelerate the vaccine development process.

Research Data and Tables

Table 1: Comparison of Key Properties of Lyssavirus Phylogroups

PropertyPhylogroup I (including DUVV)Phylogroup II
MembersRabies virus, Duvenhage virus, EBL1, EBL2, ABLMokola virus, Lagos bat virus
Glycoprotein ectodomain identity≥74% within group≤64.5% compared to Phylogroup I
Critical amino acid at position 333Arginine (R333)Aspartic acid (D333)
Pathogenicity in micePathogenic by both intracerebral and intramuscular routesPathogenic only by intracerebral route
Cross-neutralizationPresent within phylogroupAbsent between phylogroups
Protection by classical rabies vaccinesYesNo

Table 2: Glycosylation Sites in Lyssavirus Glycoproteins

VirusPotential N-glycosylation Sites
Duvenhage virusPosition 247
Mokola virusPosition 202
Lagos bat virusPositions 184, 202, and 334
Rabies virus (PV strain)Position 37 and others
Bat lyssaviruses (EBL, ABL)Minimal site in G ectodomain

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.