Recombinant E3 ubiquitin-protein ligase hrd-1 (sel-11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant E3 Ubiquitin-Protein Ligase HRD-1 (SEL-11)

Recombinant E3 ubiquitin-protein ligase HRD-1 (SEL-11) is a key enzyme involved in endoplasmic reticulum-associated degradation (ERAD), a critical quality control mechanism for misfolded or unassembled proteins in the ER. HRD-1 (HydroxyMethylglutaryl-CoA Reductase Degradation 1), also known as SYVN1 in humans, functions as the catalytic E3 ligase component of the SEL1L-HRD1 complex. This complex is evolutionarily conserved across eukaryotes and plays a pivotal role in ubiquitinating substrates for proteasomal degradation . SEL-11 (SEL1L) is the mammalian homolog of yeast Hrd3p and acts as a scaffold to stabilize HRD1 and recruit substrates .

3.1. ER-Associated Degradation (ERAD)

The SEL1L-HRD1 complex ubiquitinates ER-resident misfolded proteins, marking them for proteasomal degradation:

  • Substrates: Includes pre-B cell receptor (pre-BCR) components (VpreB, λ5) , MHC-I heavy chains , and cholera toxin CTA1 .

  • Mechanism:

    • HRD1’s RING domain transfers ubiquitin from E2 conjugases (e.g., UBE2J1) to substrates .

    • SEL-11 ensures substrate recognition and complex stability .

3.2. Immune Regulation

  • B Cell Development: HRD1 ubiquitinates pre-BCR components, regulating the transition from large to small pre-B cells .

  • Viral Evasion: HRD1 is hijacked by flaviviruses (e.g., Zika, dengue) to ubiquitinate viral NS4A protein, promoting infection .

3.3. Disease Relevance

  • Neurodegeneration: HRD1 deficiency leads to ER stress and neurodegeneration in C. elegans .

  • Cardiac Function: HRD1 is essential for mitigating ER stress in cardiomyocytes under pressure overload .

4.1. SEL1L-HRD1 Interaction is Essential for ERAD

  • The SEL1L<sup>S658P</sup> mutation disrupts HRD1 binding, causing partial embryonic lethality and cerebellar ataxia in mice .

  • Proteomic studies confirm SEL-11 recruits UBE2J1 and DERLIN-2 to HRD1, forming a functional ERAD complex .

4.2. Role in Viral Pathogenesis

  • HRD1 facilitates flavivirus infection by ubiquitinating NS4A, enhancing viral replication .

4.3. Therapeutic Implications

  • Cancer: HRD1 stabilizes oncoproteins like MALT1 in breast cancer, promoting proliferation .

  • Cholera Toxin Clearance: HRD1 and gp78 mediate retrotranslocation of cholera toxin CTA1 for degradation .

Applications of Recombinant HRD-1 (SEL-11)

ApplicationDescription
Drug DevelopmentTargeting HRD1’s RING domain inhibits viral replication (e.g., flaviviruses) .
Protein Quality ControlRecombinant HRD1-SEL11 complexes used to study ERAD mechanisms in vitro .
Gene TherapyRestoring HRD1 function in SEL1L-deficient models ameliorates ER stress .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sel-11; hrd-1; CBG23271; E3 ubiquitin-protein ligase hrd-1; RING-type E3 ubiquitin transferase hrd-1; Suppressor/enhancer of lin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-622
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis briggsae
Target Names
sel-11
Target Protein Sequence
FVINKQFYPSIVYLSKSNASMAVLYFQGIVLVYLMFQLLKSILFGDLRAAEAEHLSERTW HAVLETCLAFTVFRDDFSAMFVMQFIGLLFIKCFHWLADDRVDMMERSPVITLRFHLRMM TVLAALGFADSYFVSSAYFSTITKGASSQIVFGFEYAILLALVLHVTIKYLLHMHDLRNP QSWDNKAVYLLYAELLINLIRCVLYGFFAVIMLRVHTFPLFSVRPFYQSVRALHKAFLDV ILSRRAINAMNSQFPVVSNDELSAMDATCIICREEMTVESSPKRLPCSHVFHAHCLRSWF QRQQTCPTCRTDIWQGRNGAAGGANAGGAAENNAAGAPPAAGIPPFLPFLGHQFGFPQAA AGAQVGGAQAGGHPGPFPHQIFYAPAPANRPEFMNLAPPPMPMAGPPGMFPMMPPPPIPQ PNAAPGESSNAEPPGRPNFDRFSVEELHRMEGDMRDAILARIQAMENIMVILESAQVQMV QLAAITPLRRPVPTAEASEEETATASSVPTSVPSEEPSPAPSTPETASAPRSMFRGNLFN DTQSTSTPSTSAGPQPSLTPSTSSVPSTSSVRTPEADEVRQRRLAHLNARFPPPNPEHE
Uniprot No.

Target Background

Function
This protein acts as an E3 ubiquitin-protein ligase that specifically accepts ubiquitin from the endoplasmic reticulum-associated ubc-7 E2 ligase and transfers it to substrates, facilitating their degradation. It is a component of the endoplasmic reticulum quality control (ERQC) system, also known as the ER-associated degradation (ERAD) system, involved in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. It also promotes the degradation of normal but naturally short-lived proteins. This protein protects cells from ER stress-induced apoptosis. It is believed to play a role, alongside hsp-3, in the developmental growth and function of intestinal cells and, together with hsp-4, in gonad formation.
Database Links

STRING: 6238.CBG23271

Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of HRD1 and how does it relate to its function?

HRD1 is a polytopic membrane protein with at least six transmembrane domains (TMDs) spanning the ER lipid bilayer, possibly containing as many as eight TMDs if structurally conserved with its yeast ortholog Hrd1p. The protein contains an evolutionarily conserved N-terminal membrane-spanning region and a cytoplasmic C-terminus housing the catalytic RING (Really Interesting New Gene) domain that facilitates ubiquitin transfer from E2 ubiquitin-conjugating enzymes to substrates .

Recent structural evidence suggests that the TMDs of HRD1 form a large aqueous cavity that nearly spans the ER membrane, potentially serving as a retrotranslocation channel for lumenal ERAD substrates. This arrangement allows HRD1 to coordinate both the physical extraction of misfolded proteins from the ER and their subsequent ubiquitination in the cytosol, positioning it as a multifunctional component of the ERAD machinery .

Which protein domains of HRD1 are responsible for cofactor interactions?

HRD1 contains several distinct interaction domains that recruit specific ERAD cofactors:

  • N-terminal transmembrane region (residues 1-84): This domain, encompassing TM1 and TM2, is both necessary and sufficient for interaction with the luminal adaptor protein SEL1L, which in turn recruits OS-9 and other components involved in substrate recognition .

  • Cytoplasmic domain: The C-terminal cytoplasmic region contains an evolutionarily conserved segment termed the HAF-H domain that engages with complementary segments in the cofactors FAM8A1 and Herp (also known as HERPUD1). This domain is essential for higher-order Hrd1 complex assembly and recruitment of these specific cofactors .

  • RING domain: Located in the cytoplasmic C-terminus, this domain recruits E2 ubiquitin-conjugating enzymes such as Ube2j1 to facilitate ubiquitin transfer to substrates .

Each of these interaction domains contributes to the formation of a functional HRD1 complex capable of coordinating the multiple steps of ERAD, from substrate recognition to ubiquitination and eventual proteasomal degradation.

How does HRD1 differ from other E3 ubiquitin ligases like HOIL-1?

While both HRD1 and HOIL-1 are E3 ubiquitin ligases, they exhibit significant differences in structure, localization, and substrate specificity:

  • Structural classification: HRD1 contains a RING domain, while HOIL-1 belongs to the RING-between-RING (RBR) family of E3 ligases .

  • Subcellular localization: HRD1 is an ER-resident protein with multiple transmembrane domains, whereas HOIL-1 is a component of the linear ubiquitin chain assembly complex (LUBAC) and is not membrane-integrated .

  • Substrate specificity: HRD1 primarily ubiquitinates misfolded proteins during ERAD, targeting lysine residues. In contrast, HOIL-1 has a distinctive ability to ubiquitinate non-traditional substrates, including serine and threonine hydroxyl groups and various saccharides .

  • Catalytic mechanism: HOIL-1 contains a critical catalytic histidine residue (His510) that enables O-linked ubiquitination while prohibiting ubiquitin discharge onto lysine sidechains. This specialized mechanism is not present in HRD1, which follows a more conventional ubiquitination pathway .

Understanding these differences is crucial for researchers designing experiments that target specific ubiquitination pathways or attempting to manipulate specific E3 ligases for therapeutic purposes.

What are the experimental approaches for investigating HRD1 oligomerization and its impact on ERAD efficiency?

Investigating HRD1 oligomerization requires multifaceted experimental approaches:

  • Co-immunoprecipitation with truncation variants: Systematic analysis using HRD1 truncation variants can identify domains crucial for self-association. For example, experiments with the HAF-H domain have shown its importance in higher-order complex formation. Researchers should design constructs that progressively delete segments of the cytoplasmic domain and assess their impact on oligomerization .

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis can identify specific residues involved in HRD1-HRD1 interactions. This approach provides structural information at amino acid resolution and can be particularly valuable when coupled with computational modeling.

  • Blue native PAGE: This technique separates protein complexes in their native state and can be used to visualize higher-order HRD1 complexes of different sizes, offering insights into the oligomerization state under various conditions.

  • FRET/BRET assays: Förster/bioluminescence resonance energy transfer between differentially tagged HRD1 molecules can detect oligomerization in living cells and monitor dynamic changes in response to ER stress or substrate load.

  • Functional reconstitution: In vitro reconstitution of HRD1 complexes using purified components can determine the minimal requirements for oligomerization and assess how oligomeric state affects ubiquitination activity and substrate processing.

To link oligomerization with ERAD efficiency, researchers should conduct substrate degradation assays in parallel, using model ERAD substrates to measure degradation kinetics under conditions that favor or disrupt HRD1 oligomerization.

How can researchers identify and validate novel HRD1 substrates in different tissue contexts?

Identifying novel HRD1 substrates requires a combination of proteomics, biochemical approaches, and validation strategies:

  • Proximity-dependent biotinylation: BioID or TurboID fusions to HRD1 can label proteins in close proximity, potentially identifying both substrates and cofactors. This approach is particularly valuable for capturing transient interactions that occur during substrate processing.

  • Quantitative proteomics after HRD1 manipulation: Compare protein abundance changes in HRD1 knockout/knockdown versus control cells using SILAC or TMT labeling. Proteins that accumulate in the absence of HRD1 are potential substrates. This should be performed in tissue-specific cell types to identify context-dependent substrates.

  • Ubiquitinome analysis: Enrichment of ubiquitinated proteins followed by mass spectrometry can identify changes in ubiquitination patterns when HRD1 is manipulated. K48-linked ubiquitin chain-specific antibodies can further enrich for degradation-targeted substrates.

  • Validation approaches:

    • Direct interaction assays (co-IP, pulldowns) to confirm physical association

    • In vitro ubiquitination assays with recombinant HRD1 and candidate substrates

    • Cycloheximide chase experiments to demonstrate HRD1-dependent degradation

    • Rescue experiments where wild-type but not catalytically inactive HRD1 restores normal substrate levels

  • Tissue-specific considerations: For tissue-context studies, researchers should:

    • Use tissue-specific cell lines or primary cells

    • Consider conditional knockout models to study tissue-specific effects in vivo

    • Examine HRD1 expression levels across tissues to correlate with substrate abundance

The validation of putative substrates should always include multiple complementary approaches to establish both physical interaction with HRD1 and functional dependence on HRD1 activity.

What are the critical considerations for reconstituting functional HRD1 complexes in membrane-mimetic systems?

Reconstituting functional HRD1 complexes in membrane-mimetic systems requires careful consideration of several factors:

  • Selection of appropriate membrane mimetics:

    • Nanodiscs provide a native-like bilayer environment with controlled size

    • Liposomes allow for reconstitution of larger complexes and assessment of translocation

    • Detergent micelles may be suitable for initial solubilization but often don't recapitulate native membrane properties

    • The ER membrane contains specific lipids that may be crucial for HRD1 function; therefore, mimetics should reflect this composition

  • Protein purification strategy:

    • Expression systems (bacterial, insect, mammalian) must be chosen based on the need for post-translational modifications

    • Affinity tags should be positioned to avoid interference with transmembrane domains

    • Detergent selection during purification is critical, as it must efficiently extract HRD1 while maintaining structure and function

    • Consider co-expression of key cofactors (e.g., SEL1L) that may stabilize HRD1

  • Reconstitution of cofactors:

    • The stoichiometry of HRD1 to cofactors (SEL1L, Derlin-1, FAM8A1, Herp) must be controlled

    • The order of addition may matter, particularly for components that span different compartments

    • Consider whether components should be co-reconstituted or added sequentially

  • Functional assays:

    • Ubiquitination activity assays to verify that reconstituted HRD1 retains catalytic function

    • Substrate binding and translocation assays to assess complete ERAD functionality

    • ATPase assays if including p97/VCP to monitor extraction activity

  • Biophysical characterization:

    • Cryo-EM can provide structural insights into reconstituted complexes

    • FRET-based assays can monitor conformational changes during substrate processing

    • Single-particle tracking in larger membrane systems can reveal dynamic behavior

Researchers should systematically compare the properties and activities of reconstituted complexes with those observed in cellular systems to ensure physiological relevance.

What are the optimal expression systems and purification strategies for recombinant HRD1?

Obtaining functional recombinant HRD1 presents significant challenges due to its multiple transmembrane domains and depends on the experimental goals:

  • Expression systems:

    • Insect cells (Sf9, High Five): Often preferred for membrane protein expression due to efficient membrane protein folding machinery and eukaryotic post-translational modifications. Baculovirus expression vectors with inducible promoters provide controlled expression levels.

    • Mammalian cells (HEK293, CHO): Provide the most native environment for folding and assembly with endogenous cofactors. Transient transfection or stable cell lines with tetracycline-inducible promoters are recommended approaches.

    • Cell-free systems: Specialized cell-free systems supplemented with microsomes or nanodiscs can produce HRD1 directly into membrane-mimetic environments, avoiding extraction steps.

  • Construct design considerations:

    • Include an N-terminal or C-terminal affinity tag (His, FLAG, or Strep) with a cleavable linker

    • For structural studies, consider thermostabilizing mutations or fusion proteins

    • Truncated constructs containing specific domains may be more amenable to expression and purification

    • Co-expression with key binding partners (e.g., SEL1L) may enhance stability

  • Solubilization and purification strategies:

    • Test a panel of detergents including DDM, LMNG, GDN, and digitonin

    • Two-step purification combining affinity chromatography with size exclusion chromatography

    • Consider amphipol exchange for improved stability after initial purification

    • For functional studies, reconstitution into nanodiscs or proteoliposomes

  • Quality control checkpoints:

    • Size exclusion chromatography profiles to assess monodispersity

    • Negative stain EM to visualize particle homogeneity

    • Thermal stability assays (CPM, nanoDSF) to optimize buffer conditions

    • Verification of ubiquitination activity with model E2 enzymes and substrates

The optimal strategy should be tailored to the specific experimental goals, balancing protein yield, purity, stability, and retention of native function.

How can researchers effectively analyze the kinetics of HRD1-mediated ubiquitination in vitro?

Analyzing the kinetics of HRD1-mediated ubiquitination requires careful experimental design and quantitative analytical approaches:

  • Preparation of reaction components:

    • Purified recombinant HRD1 (wild-type and catalytic mutants)

    • Model substrate proteins (well-characterized ERAD substrates)

    • Purified E1 (UBA1) and appropriate E2 enzymes (Ube2j1, Ube2g2)

    • Ubiquitin (consider wild-type, lysine mutants, or labeled variants)

    • ATP regeneration system

  • Reaction setup and sampling:

    • Perform reactions at physiological temperature (30-37°C)

    • Include time points ranging from 15 seconds to 60 minutes

    • Quench reactions with SDS sample buffer containing reducing agent

    • For detailed kinetic analysis, use rapid quench-flow apparatus for very early time points

  • Detection and quantification methods:

    • Western blotting: Use antibodies against substrate, ubiquitin, or specific ubiquitin linkages

    • Fluorescence-based assays: Employ fluorescently labeled ubiquitin or FRET-based systems for real-time monitoring

    • Quantitative mass spectrometry: Identify specific ubiquitination sites and ubiquitin chain linkages

    • Radioactive assays: Use 32P-labeled or 125I-labeled ubiquitin for highly sensitive detection

  • Kinetic analysis approaches:

    • Determine initial rates at varying substrate and ubiquitin concentrations

    • Apply Michaelis-Menten kinetics to extract Km and kcat values

    • For chain extension, use single-turnover conditions to isolate specific steps

    • Consider more complex models for processive ubiquitination

  • Controls and validation:

    • Include RING domain mutants that abolish E2 binding

    • Test dependency on specific cofactors by their addition or omission

    • Compare activity in detergent versus membrane-reconstituted systems

    • Validate in vitro findings with cellular assays (e.g., pulse-chase experiments)

This systematic approach allows for quantitative characterization of HRD1 enzymatic properties and can reveal how various factors (e.g., membrane environment, cofactors, substrate properties) influence ubiquitination efficiency.

What techniques are most effective for visualizing HRD1 localization and dynamics in living cells?

Visualizing HRD1 localization and dynamics in living cells requires specialized imaging techniques that preserve the protein's native behavior while providing sufficient spatial and temporal resolution:

  • Fluorescent protein tagging strategies:

    • Site selection: Insert fluorescent proteins (FPs) at sites that minimize disruption of HRD1 function, ideally after computational prediction of flexible regions. The N-terminus (before TM1) or within cytoplasmic loops should be considered.

    • Tag options: mEGFP, mCherry, or HaloTag/SNAP-tag for superior brightness and photostability

    • Validation: Confirm that tagged constructs complement HRD1 knockout phenotypes and show proper ER localization

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy: Achieves 30-70 nm resolution and is suitable for visualizing HRD1 clusters relative to other ERAD components

    • Single-molecule localization microscopy (PALM/STORM): Enables precise mapping of HRD1 distribution at ~20 nm resolution and can be combined with quantitative analysis to determine oligomerization state

    • Structured illumination microscopy (SIM): Provides 100-120 nm resolution and is less photototoxic, making it suitable for longer live-cell imaging sequences

  • Dynamic imaging techniques:

    • Fluorescence recovery after photobleaching (FRAP): Measures HRD1 mobility in the ER membrane and can reveal changes in dynamics upon ER stress or substrate engagement

    • Single-particle tracking: Using photoconvertible FPs or HaloTag with minimal labeling to track individual HRD1 molecules

    • Lattice light-sheet microscopy: Enables 3D visualization with reduced photodamage for extended imaging periods

  • Interaction visualization approaches:

    • Förster resonance energy transfer (FRET): Detects direct interactions between HRD1 and cofactors or substrates

    • Bimolecular fluorescence complementation (BiFC): Visualizes specific interactions but note that the system is irreversible

    • Proximity ligation assay (PLA): While typically used in fixed cells, a modified version can be applied to living cells

  • Correlative approaches:

    • Optogenetic tools: Light-inducible clustering or activation of HRD1 to monitor downstream effects

    • Live-cell imaging followed by super-resolution on fixed samples: Captures dynamics and ultrastructure in the same cells

    • Correlative light and electron microscopy (CLEM): Combines the specificity of fluorescence with ultrastructural context

Each technique offers distinct advantages, and researchers should select methods based on the specific aspects of HRD1 biology they wish to investigate, considering the trade-offs between spatial resolution, temporal resolution, and cellular viability.

How does the conserved HAF-H domain contribute to HRD1 complex assembly and function?

The HAF-H domain is an evolutionarily conserved segment within the intrinsically disordered cytoplasmic domain of HRD1 that plays a critical role in complex assembly and ERAD function:

Understanding the HAF-H domain provides crucial insights into how HRD1 coordinates the assembly of the multiprotein complex required for efficient identification, retrotranslocation, and ubiquitination of ERAD substrates.

What experimental approaches can distinguish between substrate-bound and free forms of HRD1?

Distinguishing between substrate-bound and free forms of HRD1 requires techniques that can detect conformational changes or altered interactions:

These approaches can be combined to build a comprehensive understanding of how substrate binding induces changes in HRD1 structure and function, providing insights into the mechanisms of substrate recognition and processing.

How are HRD1 mutations or dysregulation associated with specific human diseases?

The ubiquitin ligase HRD1 plays crucial roles in ER quality control and stress responses, making its dysregulation potentially significant in various diseases:

  • Neurodegenerative disorders:

    • In Parkinson's disease models, HRD1 has been implicated in the degradation of Parkin and α-synuclein

    • Reduced HRD1 function may contribute to protein aggregation in Alzheimer's disease through impaired clearance of misfolded proteins

    • HRD1 polymorphisms have been associated with increased risk for certain neurodegenerative conditions

  • Rheumatoid arthritis:

    • HRD1 (synoviolin) overexpression has been observed in rheumatoid arthritis synovial cells

    • Elevated HRD1 levels contribute to synovial cell hyperplasia and inflammation

    • Animal models with HRD1 overexpression develop spontaneous arthropathy

  • Cancer progression:

    • HRD1 upregulation has been reported in various cancers, including breast, colon, and ovarian cancers

    • Oncogenic functions may include degradation of tumor suppressors and regulation of ER stress-induced apoptosis

    • HRD1 may contribute to chemotherapy resistance through modulation of ER stress responses

  • Metabolic disorders:

    • HRD1 participates in the regulation of key metabolic enzymes and receptors

    • Dysregulation has been linked to insulin resistance and non-alcoholic fatty liver disease

    • HRD1 may influence lipid metabolism through degradation of rate-limiting enzymes

  • Genetic diseases involving protein misfolding:

    • Mutations affecting HRD1 function may impair degradation of misfolded disease-associated proteins

    • HRD1 activity modulates the severity of diseases caused by misfolded secretory or membrane proteins

    • Genetic variants affecting HRD1-cofactor interactions could represent risk factors for protein misfolding diseases

Understanding these disease associations provides rationale for targeting HRD1 pathway components therapeutically, either to enhance function (for neurodegenerative diseases) or inhibit overactivity (for rheumatoid arthritis or certain cancers).

How has the HRD1 complex evolved across species, and what are the functional implications of these differences?

The evolution of the HRD1 complex across species reveals both conserved core functions and lineage-specific adaptations:

  • Core conserved elements:

    • The RING domain structure and catalytic mechanism for ubiquitin transfer are highly conserved from yeast to humans

    • The requirement for multi-protein complexes to conduct ERAD is universal

    • The transmembrane organization forming a channel-like structure appears conserved from yeast to mammals

  • Yeast versus mammalian complexes:

    • Yeast Hrd1p forms a complex with Hrd3p (SEL1L in mammals), Der1p (Derlin-1 in mammals), and Usa1p

    • Mammals have evolved additional components including Herp and FAM8A1, which are not present in yeast

    • The HAF-H domain in mammalian Hrd1 represents a metazoan-specific adaptation for complex assembly

  • Substrate recognition evolution:

    • Yeast ERAD relies heavily on glycan-based signals for misfolded protein detection

    • Mammalian systems have evolved more diverse recognition mechanisms, including direct peptide recognition and specialized adaptors

    • This diversification likely reflects the increased complexity of the mammalian secretome

  • Regulatory complexity:

    • Mammalian HRD1 is subject to more complex transcriptional and post-translational regulation

    • Stress-responsive elements in mammalian HRD1 promoters have evolved to integrate with broader cellular stress responses

    • Additional regulatory cofactors provide more nuanced control over HRD1 activity in higher eukaryotes

  • Functional implications:

    • The increased complexity in mammals likely supports tissue-specific ERAD functions

    • Additional cofactors may facilitate specialization for different classes of substrates

    • Enhanced regulatory control allows integration with other cellular quality control pathways

These evolutionary differences highlight how the core ERAD function has been adapted and expanded in higher organisms to handle the increased complexity of the proteome and cellular organization. Understanding these differences is crucial for translating findings between model organisms and human systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.