Recombinant Eastern equine encephalitis virus Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Role in Viral Replication and Pathogenesis

The structural polyprotein drives EEEV’s rapid replication cycle, which produces infectious virions within 3–4 hours post-infection . Key findings include:

  • Ribosome recruitment: High ribosome density on viral RNA (mean spacing: 212 nucleotides) accelerates structural protein synthesis, enabling rapid virion assembly .

  • Post-translational processing: Cleavage of the polyprotein into mature components is rate-limited by translocation to the endoplasmic reticulum or spike protein maturation .

Table 2: Functional Domains and Cleavage Products

DomainFunctionCleavage Product
CapsidGenome binding, nucleocapsid assemblyCapsid protein
PE2 (E3-E2)Spike precursorMature E2 glycoprotein
6K-E1Membrane fusionE1 glycoprotein

Vaccine Development

Recombinant structural polyproteins self-assemble into virus-like particles (VLPs), which are noninfectious but immunogenic. Studies demonstrate their utility in:

  • VLP-based vaccines: EEEV VLPs elicit neutralizing antibodies in preclinical models .

  • Cross-protection: Chimeric polyproteins incorporating elements from related alphaviruses (e.g., Western equine encephalitis virus) show broad-spectrum potential .

Antiviral Target Identification

  • Receptor interactions: The E2 glycoprotein binds heparan sulfate (HS) and very-low-density lipoprotein receptor (VLDLR), which are critical for viral entry . Structural analyses reveal conserved HS-binding residues that could be targeted by inhibitors .

  • Ribosome recruitment: Small molecules disrupting ribosome-viral RNA interactions reduce virion production by >90% .

Challenges and Future Directions

  • Thermostability: Recombinant polyproteins degrade rapidly, necessitating stabilizing additives for storage .

  • Strain variability: North American EEEV strains exhibit higher neurovirulence than South American strains, linked to structural gene differences .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
800-1240
Protein Length
Full Length of Mature Protein
Species
Eastern equine encephalitis virus (strain va33[ten broeck]) (EEEV) (Eastern equine encephalomyelitis virus)
Target Protein Sequence
YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTSIIPSTNLEYITCKYKTKVPSPVV KCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAK AYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVV YGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSG FERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDL ECKITECTYASDFGGIATLPTNPVKQETVQFILHQVLQLLKRMTSPLLRAGSFTFHFSTA NIHPAFKLQVCTSGVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA FIVLGLIATAVVALVLFFHRH
Uniprot No.

Target Background

Function
The Eastern equine encephalitis virus (EEEV) structural polyprotein assembles into an icosahedral capsid (T=4 symmetry) comprising 240 copies of the capsid protein, enveloped by a lipid membrane containing 80 spikes formed by E1-E2 heterodimer trimers. The capsid protein binds viral RNA near a ribosome binding site, facilitating translation post-genome release. It possesses autocatalytic protease activity, cleaving itself from the nascent structural protein. After self-cleavage, it transiently interacts with ribosomes before binding viral RNA and rapidly assembling into icosahedral core particles. This nucleocapsid associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to virion budding. Following infection, virions bind to target cells, undergo clathrin-mediated endocytosis, and fuse with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. Uncoating, potentially triggered by ribosome interaction with capsid proteins (releasing genomic RNA from its binding site), renders the genomic RNA accessible. The polyprotein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, evading innate immune detection before gene expression. It also inhibits host transcription by forming a tetrameric complex with XPO1/CRM1 and importin, blocking nuclear pore channels and thus inhibiting receptor-mediated nuclear transport and host mRNA/rRNA transcription. This transcriptional inhibition is linked to cytopathic effects. The polyprotein provides a signal sequence for E3/E2 precursor translocation to the host endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, protecting it at low pH during secretion. Post-virion release, E3 is gradually released extracellularly. E2, crucial for viral attachment via cell receptor binding, is synthesized as a p62 precursor. Furin processing at the cell membrane before budding yields the E2-E1 heterodimer. While p62-E1 is stable, E2-E1 is unstable, dissociating at low pH. p62 processing likely prevents premature E1 fusion activation before cell surface export. E2's C-terminus contains a transient transmembrane domain, disrupted by palmitoylation, reorienting the C-terminal tail from lumenal to cytoplasmic. This is crucial for budding via interaction with capsid proteins. This cytoplasmic release occurs late in protein export, preventing premature assembly at the endoplasmic reticulum. The 6K protein, a constitutive membrane protein, participates in glycoprotein processing, cell permeabilization, and virion budding. It disrupts calcium homeostasis, likely at the endoplasmic reticulum, causing cytoplasmic calcium elevation. Its lipophilicity suggests a role in lipid selection, impacting membrane deformability essential for budding. Present in low virion concentrations (∼3% of glycoproteins), 6K is a class II viral fusion protein. E1's fusion activity, inactive when bound to E2 in mature virions, is activated by endosomal acidification, causing E1/E2 dissociation and E1 trimerization. This active E1 trimer mediates fusion, releasing the nucleocapsid into the cytoplasm. Efficient fusion requires target membrane cholesterol and sphingolipids, optimally at a 1:2 cholesterol:phospholipid ratio, specific for sterols with a 3-beta-hydroxyl group.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the composition of the EEEV structural polyprotein?

The EEEV structural polyprotein is encoded by the subgenomic RNA (sgRNA) and consists of capsid (C), E3, E2, 6K, and E1 proteins. Initially, the structural polyprotein undergoes auto-proteolytic cleavage to release the capsid protein, followed by translocation of the remaining polyprotein (PE26KE1) to the endoplasmic reticulum. Subsequently, the remaining polyprotein undergoes several post-translational processing steps through the secretory pathway, resulting in mature structural proteins necessary for viral particle assembly .

What are the key structural features of EEEV that distinguish it from other alphaviruses?

EEEV possesses specific binding sites for heparan sulfate (HS) proteoglycans that serve as host attachment factors/receptors for infection. Cryo-EM studies have identified both "peripheral" and "axial" HS binding sites on the EEEV structure. The peripheral sites are associated with the base of each E2 glycoprotein that forms the 60 quasi-threefold spikes and the 20 sites at the icosahedral threefold axes. Additionally, there is one HS site at the vertex of each spike (the axial sites). These binding sites are surrounded by basic residues, suggesting an electrostatic mechanism for HS binding .

How can I express recombinant EEEV structural polyprotein in mammalian cells?

To express recombinant EEEV structural polyprotein in mammalian cells, you can use vectors encoding the structural polyprotein genes. This approach has been successfully employed in the development of virus-like particle (VLP) based vaccines for Eastern, Western, and Venezuelan equine encephalitis viruses. When expressed, the structural polyprotein undergoes normal processing steps, including auto-proteolytic cleavage of the capsid, translocation of the remaining polyprotein to the endoplasmic reticulum, and subsequent processing in the secretory pathway .

What are the rate-limiting steps in EEEV structural polyprotein processing?

Hierarchical clustering analysis of model species trajectories has identified three distinct clusters that differ in their distributions of parameters describing the processing steps of the structural polyproteins. Each cluster is characterized by one of three rate parameters being significantly lower and more tightly constrained: structural polyprotein translocation to the endoplasmic reticulum, polyprotein post-translational modifications in the secretory pathway, or cleavage of the spike proteins. This suggests that any of these three steps can be rate-limiting in EEEV structural polyprotein processing, impacting the efficiency of viral particle production .

How do ribosome density and polysome formation affect EEEV replication dynamics?

The density of host ribosomes on viral RNA significantly impacts EEEV replication dynamics. Modeling studies predict that EEEV rapidly recruits and densely packs host ribosomes on its viral RNA to accelerate replication. This dense packing of host ribosomes is critical for establishing the characteristic positive-to-negative RNA strand ratio because of its role in governing transcription kinetics. Computational models suggest that a reduction in ribosome density leads to greater production of the negative-sense template strand and delayed production of infectious viral particles .

What experimental approaches can resolve contradictions in EEEV RNA strand ratio measurements?

To address contradictions in RNA strand ratio measurements, implement strand-specific RT-qPCR with improved sensitivity. When standard approaches prove insufficient, consider integrating experimental data with mathematical modeling constraints. Bayesian inference methods can incorporate both direct measurements and biological constraints (such as the expected RNA genome strand ratio of 10-20 based on previous experiments with related alphaviruses) to calibrate model parameters. This approach allows for the reconciliation of experimental limitations while maintaining biological relevance in the analysis of viral replication dynamics .

How does the structure of EEEV facilitate host cell attachment?

The cryo-EM structure of EEEV complexed with heparin (a heparan sulfate analog) at 5.8-Å resolution reveals specific binding sites that facilitate host cell attachment. The interaction between the viral envelope protein E2 and heparan sulfate proteoglycans on the host cell surface influences EEEV neurovirulence. Both the axial and peripheral HS binding sites on the virus are surrounded by basic residues that are highly conserved among EEEV strains. This suggests an electrostatic mechanism for HS binding, and changes in these residues might be linked to alterations in EEEV neurovirulence .

What is the difference between infectious particle formation and virus-like particle assembly in EEEV?

The formation of infectious viral particles (plaque-forming units, PFUs) requires the capsid proteins to first bind to the cytoplasmic genome, followed by assembly with mature spike proteins into infectious particles that bud from the cell membrane. In contrast, virus-like particles (VLPs) form when the capsid self-assembles without prior binding to the genome, resulting in non-infectious particles. This distinction is supported by studies with Venezuelan Equine Encephalitis virus showing that non-infectious VLPs are produced without the genome binding to the capsid, yielding genome-free particles .

How can structural information about EEEV be utilized to design antiviral strategies?

The identified heparan sulfate binding sites on EEEV serve as potential targets for the development of antiviral agents. Given that there are currently no approved antiviral treatments for EEEV infection, these structural insights provide valuable opportunities for therapeutic development. Additionally, sensitivity analysis of the viral replication cycle has identified viral transcription, particularly of the genome and subgenome, as most critical for infectious viral particle production, making it a promising target for future therapeutic interventions .

What are the key parameters to monitor when studying EEEV replication kinetics?

When studying EEEV replication kinetics, monitor the following key parameters: (1) viral RNA levels, distinguishing between positive-sense genome (posRNA), negative-sense template strand (negRNA), and subgenomic RNA (sgRNA); (2) nonstructural and structural protein expression; (3) infectious particle (PFU) production; (4) the RNA genome strand ratio (posRNA/negRNA); and (5) the particle-to-PFU ratio. Quantitative measurements of these parameters over time provide essential data for understanding the viral replication cycle and for calibrating mathematical models that can predict critical steps in viral replication .

How does EEEV differ from other RNA viruses in its replication cycle?

EEEV exhibits remarkably efficient replication in neurons, producing progeny viral particles as soon as 3-4 hours post-infection, which is notably faster than viruses like SARS-CoV-2. The virus employs a strategy of rapidly concentrating host ribosomes densely on viral RNA and allocating the majority of progeny genome copies to the cytoplasm for assembly. EEEV maintains a tightly regulated balance in the synthesis rates of the full-length genome, negative-sense template strand, and subgenome through (1) rapid transition of the replicase from negative-sense to positive-sense transcribing forms and (2) a constrained ratio between the genome and subgenome promoter affinities .

What methodological approaches enable accurate quantification of structural polyprotein processing in EEEV infection?

To accurately quantify structural polyprotein processing during EEEV infection, implement pulse-chase experiments combined with immunoprecipitation to track the different processing intermediates: the full structural polyprotein, the polyprotein after capsid release (PE26KE1), the translocated polyprotein in the endoplasmic reticulum (PE26KE1-ER), and the precursor spike proteins (PE2-E1). Complement these experiments with mathematical modeling approaches that incorporate Bayesian inference methods to estimate processing rates for each step and identify rate-limiting steps in polyprotein maturation. This integrated experimental and computational approach provides deeper insights into the dynamics of viral protein processing than either method alone .

How can rule-based modeling be applied to study EEEV replication dynamics?

Rule-based modeling provides a powerful framework for studying EEEV replication dynamics by encoding alphavirus-specific replication steps into a series of interpretable rate rules. This approach encompasses attachment of viral particles to host attachment factors through the release of progeny particles with varying infectivity. For EEEV, this methodology has successfully captured the complex interactions between viral components and host machinery, particularly the utilization of host ribosomes. When combined with Bayesian inference methods for parameter estimation using experimental data, rule-based models can reveal critical insights into replication mechanisms not directly observable through experiments alone .

What are the optimal experimental conditions for studying EEEV structural polyprotein expression and processing?

For optimal study of EEEV structural polyprotein expression and processing, use mammalian fibroblast cells maintained at 37°C with appropriate biosafety measures for this BSL-3 pathogen. Infect cells at a multiplicity of infection (MOI) of 10 to ensure synchronous infection, and collect time points within the first 13 hours post-infection to capture the rapid kinetics of viral replication. Employ strand-specific RT-qPCR for RNA quantification, luminescence-based reporters for protein expression, and plaque assays for infectious particle quantification. Combine these approaches with protein labeling techniques to track the processing intermediates of the structural polyprotein through the secretory pathway .

How can researchers exploit the EEEV structural polyprotein to develop virus-like particle vaccines?

To develop VLP-based vaccines using the EEEV structural polyprotein, design expression vectors encoding the complete structural polyprotein genes but lacking the viral genome and nonstructural proteins. This approach allows for the formation of non-infectious VLPs that maintain the antigenic properties of the native virus. Optimize the expression system to ensure efficient polyprotein processing through the secretory pathway, as any rate-limiting steps identified in processing could impact VLP production. Consider modifying specific residues in the heparan sulfate binding sites of the E2 protein to potentially enhance immunogenicity while maintaining the structural integrity necessary for VLP formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.