Recombinant Echinosorex gymnura NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its functional significance in cellular metabolism?

MT-ND4L (mitochondrially encoded NADH:ubiquinone oxidoreductase chain 4L) is an essential component of the mitochondrial respiratory complex I. This protein plays a crucial role in the first step of the electron transport process during oxidative phosphorylation, specifically facilitating the transfer of electrons from NADH to ubiquinone .

Complex I, which contains MT-ND4L, is embedded in the inner mitochondrial membrane and participates in creating an unequal electrical charge on either side of this membrane through the step-by-step transfer of electrons. This electrochemical gradient is fundamental to ATP production, which serves as the cell's primary energy source .

The MT-ND4L protein is particularly interesting because it is encoded by mitochondrial DNA rather than nuclear DNA, making it subject to unique evolutionary constraints and inheritance patterns. In Echinosorex gymnura (moon rat), this protein consists of 98 amino acids and functions as a multi-pass membrane protein within the mitochondria .

How is Echinosorex gymnura MT-ND4L structurally characterized?

The Echinosorex gymnura MT-ND4L protein has the following structural characteristics:

• Complete amino acid sequence: MQMTMINMILAFIMATGLLMFRSHFMSSLCLEGMMLSIFIMSISTLNFNNSLAMFPLVLLVFAACEAAIGLSLLVKISNTYGTDYVQNLNLLQC

• Protein mass: Approximately 10.74 kDa (based on homologous proteins)

• Structural type: Multi-pass membrane protein embedded in the mitochondrial inner membrane

• Functional domain: Contains regions essential for electron transport within complex I

• Uniprot identification number: Q953L2

The protein's hydrophobic nature is evident from its amino acid sequence, which contains multiple membrane-spanning domains that anchor it within the inner mitochondrial membrane. These structural properties are critical for its function in the electron transport chain and its interaction with other components of complex I.

What conservation patterns does MT-ND4L show across mammalian species?

MT-ND4L demonstrates notable evolutionary conservation across mammalian species, reflecting its essential role in mitochondrial function. Comparative studies of complete mitochondrial genomes, including that of Echinosorex gymnura, have provided valuable insights into mammalian phylogeny and the evolution of this protein .

The gymnure (Echinosorex gymnura) MT-ND4L sequence has been particularly valuable in resolving certain phylogenetic relationships within Eulipotyphla (previously Insectivora). With the availability of the gymnure mitochondrial DNA sequence, researchers have been able to place the previously problematic hedgehog position in the mammalian evolutionary tree, confirming the monophyly of Eulipotyphla (moles, shrews, and hedgehogs) .

Conservation analysis shows that functional domains involved in electron transport tend to be highly conserved, while regions less critical for catalytic function may show greater variability. This pattern of conservation provides valuable information for understanding both the functional constraints on the protein and its evolutionary history.

What are the optimal storage and handling conditions for recombinant Echinosorex gymnura MT-ND4L?

For optimal research outcomes, recombinant Echinosorex gymnura MT-ND4L should be handled according to these specific guidelines:

The recombinant protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . To maintain structural integrity and biological activity, it's crucial to avoid repeated freeze-thaw cycles, as this can lead to protein denaturation and loss of function. Instead, preparing small working aliquots for immediate use is recommended .

How can researchers validate the specificity and activity of recombinant MT-ND4L preparations?

Validating both the specificity and functional activity of recombinant MT-ND4L is essential for reliable experimental outcomes. A comprehensive validation protocol should include:

• Immunological verification: Using validated antibodies against MT-ND4L to confirm protein identity through Western blotting or ELISA. Antibody specificity should be tested on tissues known to express MT-ND4L positively and negatively .

• Mass spectrometry analysis: To confirm the protein's mass (approximately 10.74 kDa) and amino acid sequence integrity.

• Functional assays:

  • NADH oxidation assay to measure electron transfer activity

  • Ubiquinone reduction assay to assess the protein's ability to transfer electrons to ubiquinone

  • Complex I assembly analysis using blue native gel electrophoresis

• Protein-protein interaction studies: To verify proper interaction with other components of complex I.

• Subcellular localization: Confirm proper mitochondrial membrane localization using fractionation studies or fluorescent tagging in cellular models.

For definitive validation, researchers should incorporate both positive controls (known functional MT-ND4L) and negative controls (samples lacking MT-ND4L) in their experimental design to establish baseline measurements and determine specific activity levels.

What techniques are effective for studying MT-ND4L interactions within the respiratory complex?

Investigating MT-ND4L's interactions within respiratory complex I requires specialized techniques that preserve native protein interactions. The following methodological approaches have proven effective:

• Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact protein complexes while maintaining their native state, allowing visualization of MT-ND4L incorporation into complex I.

• Co-immunoprecipitation (Co-IP): Using antibodies against MT-ND4L or other complex I components to pull down interaction partners, followed by mass spectrometry identification.

• Proximity-based labeling techniques:

  • BioID (proximity-dependent biotin identification)

  • APEX (engineered ascorbate peroxidase)
    These methods tag proteins that come into close proximity with MT-ND4L in its native environment.

• Cryo-electron microscopy: For structural analysis of the entire complex I with MT-ND4L in its native conformation.

• Crosslinking mass spectrometry: Chemical crosslinking of interacting proteins followed by mass spectrometry analysis can identify precise interaction interfaces.

• Förster Resonance Energy Transfer (FRET): To study dynamic interactions between MT-ND4L and other components when expressed with appropriate fluorescent tags.

These techniques should be applied in complementary fashion to build a comprehensive understanding of how MT-ND4L contributes to complex I structure and function.

How can genetic editing tools be applied to study MT-ND4L function in model organisms?

Advanced genetic editing approaches provide powerful methods for investigating MT-ND4L function. The MitoKO system represents a significant advancement for mitochondrial gene research:

The MitoKO system employs DdCBEs (DddA-derived cytosine base editors) to precisely target and edit mitochondrial DNA, allowing for the introduction of premature stop codons in mitochondrial genes . For most mitochondrial genes, this system changes tryptophan codons (TGA) into stop codons (TAA) by deaminating cytosine on the non-coding strand .

For MT-ND4L specifically, researchers have designed approaches to change the coding sequence for Val90 and Gln91 (GTCCAA) into Val and STOP (GTT-) . This precise editing capability allows for targeted knockout of MT-ND4L while minimizing off-target effects.

The experimental workflow for applying MitoKO to study MT-ND4L typically involves:

• Design of specific TALE domains binding the mtDNA light or heavy strands

• Construction of DdCBE pairs containing different combinations of the 1333 DddAtox split

• Delivery of the constructs to mitochondria using appropriate targeting sequences

• Verification of editing efficiency using sequencing

• Functional analysis of the effects of MT-ND4L knockout on mitochondrial respiration and cellular energy metabolism

This approach offers unprecedented specificity for mitochondrial gene knockout studies, enabling detailed investigation of MT-ND4L's role in complex I assembly, stability, and function.

What are the implications of MT-ND4L mutations for mitochondrial disease research?

MT-ND4L mutations have significant implications for understanding mitochondrial pathology, with particular relevance to Leber hereditary optic neuropathy (LHON). The mutation T10663C (Val65Ala) in MT-ND4L has been identified in several families with LHON, although the precise mechanism by which this mutation leads to vision loss remains to be fully determined .

Research methodologies for investigating MT-ND4L mutations in disease contexts include:

• Patient-derived cell models: Fibroblasts or induced pluripotent stem cells from patients with MT-ND4L mutations can be differentiated into relevant cell types (e.g., retinal ganglion cells for LHON studies).

• Cybrid technology: Transfer of patient mitochondria into ρ0 cells (cells depleted of mtDNA) to isolate the effects of mtDNA mutations from nuclear genetic background.

• Functional assays:

  • Complex I activity measurements

  • Oxygen consumption analysis

  • ATP production quantification

  • Reactive oxygen species (ROS) measurements

  • Mitochondrial membrane potential assessment

• Comparative analysis: Studying the effects of the same MT-ND4L mutation across different species or cellular contexts to identify factors that influence penetrance and expressivity.

Understanding how MT-ND4L mutations affect complex I function provides insight into the pathophysiology of mitochondrial diseases and may reveal potential therapeutic targets. The recombinant Echinosorex gymnura MT-ND4L protein serves as a valuable tool for comparative studies with human mutant variants.

How can recombinant MT-ND4L be integrated into drug screening platforms?

Recombinant MT-ND4L can be strategically incorporated into drug screening platforms to identify compounds that modulate complex I activity or mitigate the effects of pathogenic mutations. Methodological approaches include:

• In vitro activity assays: Using purified recombinant MT-ND4L reconstituted with other complex I components to screen for compounds that enhance or restore electron transport activity.

• Structure-based virtual screening: Utilizing the structural data of MT-ND4L to identify small molecules that might bind to critical regions and alter function.

• Cellular assays:

  • Integration of recombinant MT-ND4L into cellular models with MT-ND4L deficiency

  • Measurement of complex I assembly and function following compound treatment

  • Evaluation of mitochondrial respiration and ATP production

• High-throughput screening applications:

Compounds identified through these screening approaches could potentially be developed into therapeutics for mitochondrial diseases caused by MT-ND4L dysfunction or used as research tools to further understand complex I biology.

How can Echinosorex gymnura MT-ND4L contribute to understanding mitochondrial evolution?

Echinosorex gymnura (moon rat) MT-ND4L provides valuable insights into mammalian mitochondrial evolution due to the species' phylogenetic position within Eulipotyphla. This taxonomic group occupies a deep branch within Laurasiatheria, making it particularly informative for evolutionary analyses .

Methodological approaches for utilizing MT-ND4L in evolutionary studies include:

• Comparative sequence analysis: Alignment of MT-ND4L sequences across diverse mammalian species to identify conserved functional domains and lineage-specific adaptations.

• Molecular clock analyses: Using MT-ND4L sequence divergence to estimate divergence times between mammalian lineages.

• Selection pressure analysis: Calculating dN/dS ratios across different lineages to identify sites under positive or purifying selection.

• Ancestral sequence reconstruction: Inferring the sequence of ancestral MT-ND4L proteins to understand the evolutionary trajectory of this gene.

The gymnure MT-ND4L sequence has already contributed significantly to resolving phylogenetic relationships, particularly within Eulipotyphla. Prior to the availability of the gymnure complete mitochondrial genome, the hedgehog appeared in an aberrant position in mammalian phylogenetic trees. The addition of gymnure data helped establish the monophyly of Eulipotyphla for the first time in mitochondrial-based trees .

This highlights the importance of sampling key taxonomic groups to break up long branches in phylogenetic analyses and resolve ambiguous relationships in mammalian evolution.

What techniques are most effective for comparative studies between Echinosorex gymnura MT-ND4L and orthologues from other species?

For robust comparative studies between Echinosorex gymnura MT-ND4L and its orthologues, researchers should employ a multi-faceted methodological approach:

These methodological approaches provide a comprehensive framework for understanding how MT-ND4L has evolved across different mammalian lineages and how its structure-function relationship has been conserved or modified throughout evolutionary history.

What are the key challenges in expressing and purifying functional recombinant MT-ND4L?

Producing functional recombinant MT-ND4L presents several technical challenges due to its properties as a hydrophobic membrane protein. Researchers should be aware of these challenges and implement appropriate methodological solutions:

The commercially available recombinant Echinosorex gymnura MT-ND4L has been optimized through the production process to address these challenges . The protein is provided with a tag (though the specific tag type is determined during the production process) and stabilized in a Tris-based buffer with 50% glycerol .

For researchers producing their own recombinant MT-ND4L, expression in specialized systems designed for membrane proteins, such as bacterial strains with enhanced membrane protein expression capabilities or cell-free systems supplemented with lipid nanodiscs, may improve yields of functional protein.

How can researchers distinguish between direct effects of MT-ND4L alterations and secondary mitochondrial responses?

Differentiating primary from secondary effects in MT-ND4L studies requires careful experimental design and multiple complementary approaches:

• Temporal analysis: Monitoring changes over time following MT-ND4L alteration to distinguish immediate effects (likely primary) from delayed responses (potentially secondary).

• Dose-response relationships: Examining how the magnitude of MT-ND4L alteration correlates with observed phenotypes.

• Rescue experiments: Re-expressing wild-type MT-ND4L in knockout/knockdown systems to determine which phenotypes are directly attributable to MT-ND4L loss.

• Comparative analysis across models: Testing MT-ND4L alterations in different cell types or organisms to identify consistent primary effects versus context-dependent secondary responses.

• Systems biology approaches:

  • Multi-omics analysis (proteomics, metabolomics, transcriptomics)

  • Network analysis to map direct interactions versus downstream pathways

  • Mathematical modeling of mitochondrial function with and without MT-ND4L

• Isolation of mitochondrial function:

  • In vitro reconstitution of respiratory complexes

  • Isolated mitochondria experiments

  • Permeabilized cell assays

These methodological approaches, used in combination, provide a more comprehensive understanding of MT-ND4L's direct functional role versus the broader cellular adaptations that occur in response to its alteration.