Recombinant Ectocarpus siliculosus Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Biological Role of PsbA in Photosystem II

The PsbA protein (encoded by the psbA gene) forms the reaction center of PSII, binding cofactors essential for water splitting and electron transfer. Key functions include:

  • QB Binding: PsbA harbors the QB site, a plastoquinone-binding pocket critical for electron transfer to the cytochrome b6f complex .

  • Photoprotection: Mutations in PsbA (e.g., near the QB site) alter electron transport rates and photochemical regulation, as observed in diatoms .

  • Structural Conservation: The D1/D2 heterodimer in PSII is evolutionarily conserved across oxygenic phototrophs, including algae and plants .

Recombinant Production and Characterization

While recombinant Ectocarpus siliculosus PsbA has not been explicitly documented, insights can be drawn from homologous proteins:

Comparative Analysis of Recombinant Algal PsbA Proteins

FeatureProchlorococcus marinus PsbA Prorocentrum micans PsbA
HostE. coliE. coli
TagN-terminal HisN-terminal His
Length345 aa343 aa
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS + 6% Trehalose-20°C/-80°C in Tris/PBS + 6% Trehalose

These systems suggest that E. siliculosus PsbA could similarly be produced in E. coli with a His tag, given the high conservation of psbA sequences .

Genomic and Transcriptomic Insights

  • Gene Expression: E. siliculosus PSII-related genes, including psbA, are regulated under abiotic stress (e.g., salinity, temperature) . Specific isoforms may enhance photochemical efficiency under fluctuating light conditions.

  • Evolutionary Adaptations: Chromerid algae (e.g., Chromera velia) exhibit PSII subunit losses, but Ectocarpus retains core subunits like PsbA, indicating functional indispensability .

Functional Mutational Studies

Research on diatom (Phaeodactylum tricornutum) PsbA highlights:

  • QB Pocket Mutations: Substitutions near the QB site (e.g., D1-V249A) reduce electron transport rates and alter herbicide resistance .

  • Conservation Across Taxa: Mutational effects in diatoms mirror those in cyanobacteria and green algae, underscoring PsbA’s structural universality .

Challenges and Future Directions

  • Heterologous Expression: Producing functional E. siliculosus PsbA may require optimizing codon usage or chaperone co-expression to address folding issues common in membrane proteins .

  • Cryo-EM/Structural Studies: High-resolution structures of Ectocarpus PSII could clarify unique adaptations, such as interactions with light-harvesting complexes .

  • Stress Responses: Transcriptomic data suggest E. siliculosus PsbA isoforms may differentially respond to environmental stressors, warranting isoform-specific studies .

Potential Applications

  • Photosynthesis Research: Recombinant PsbA enables in vitro studies of electron transport mechanisms and photodamage repair.

  • Biotechnology: Engineered PsbA variants could improve algal biomass productivity under stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Ectocarpus siliculosus (Brown alga) (Conferva siliculosa)
Target Names
psbA
Target Protein Sequence
MVATLERREEKRDWGTFATWITSTENRLYIGWFGCLMIPTLLTAASCYIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVIPSSNAIGIHFYPIWEAASIEEWLYNGGPYQLIVFHFL IGVACWMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMRPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEVESVNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTALGVSTMAFNLNGF NFNQSVVDSEGRVINTWADIINRADLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ectocarpus siliculosus Photosystem Q(B) protein and what is its fundamental role in photosynthesis?

The Photosystem Q(B) protein (EC 1.10.3.9) is a critical component of Photosystem II (PSII), functioning as the light-driven water/plastoquinone photooxidoreductase in Ectocarpus siliculosus, a brown alga. This protein plays a central role in the planetary energy cycle by facilitating electron transfer from water to plastoquinone. PSII catalyzes the oxidation of water and reduction of plastoquinone, with the Photosystem Q(B) protein specifically housing the binding site for the exchangeable quinone (QB) . The protein serves as the site where plastoquinone (PQ) is converted to plastohydroquinone (PQH2), which is subsequently released into the thylakoid membrane, allowing another PQ from the membrane pool to bind to the QB site .

What are the structural characteristics of Ectocarpus siliculosus Photosystem Q(B) protein?

The Photosystem Q(B) protein from Ectocarpus siliculosus is a 344-amino acid protein with a molecular weight of approximately 32 kDa. Its full amino acid sequence is: MVATLERREEKRDWGTFATWITSTENRLYIGWFGCLMIPTLLTAASCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVIPSSNAIGIHFYPIWEAASIEEWLYNGGPYQLIVFHFLIGVACWMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMRPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEVESVNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTALGVSTMAFNLNGFNFNQSVVDSEGRVINTWADIINRADLGMEVMHERNAHNFPLDLA . The protein is embedded in the thylakoid membrane as an integral membrane protein, containing transmembrane domains that anchor it within the lipid bilayer, positioning the QB binding site appropriately for its function in electron transport.

How should recombinant Ectocarpus siliculosus Photosystem Q(B) protein be properly stored and handled in laboratory settings?

For optimal preservation of recombinant Ectocarpus siliculosus Photosystem Q(B) protein, storage in a Tris-based buffer containing 50% glycerol is recommended. The protein should be stored at -20°C for regular use, while -80°C is preferred for extended storage to maintain stability and activity . When working with the protein, it's advisable to avoid repeated freeze-thaw cycles as these can degrade protein structure and function. Creating working aliquots stored at 4°C that can be used for up to one week is a practical approach to minimize freeze-thaw damage. During experimental procedures, the protein should be kept on ice when not in use to prevent denaturation and maintain its functional properties.

What basic experimental techniques are commonly employed to study Photosystem Q(B) protein?

Several fundamental techniques are routinely used to study the Photosystem Q(B) protein:

  • ELISA (Enzyme-Linked Immunosorbent Assay): Used for quantitative detection and analysis of the protein

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Particularly valuable for studying the redox properties of the QB site and detecting the semiquinone intermediate (QB- −)

  • Immunolocalisation: Using specific antibodies to visualize protein localization within cells or tissues, as employed in related studies of Ectocarpus proteins

  • Quantitative RT-PCR: For measuring gene expression levels of the protein in different tissues or under various conditions

  • Sequence Analysis and Alignment: For comparative studies with homologous proteins from other species to understand evolutionary relationships and conserved functional domains

What are the redox properties of the QB site in Photosystem II and how do they influence electron transport efficiency?

The redox properties of the QB site are fundamental to understanding electron transport in Photosystem II. Research using EPR spectroscopy with Thermosynechococcus elongatus (which can provide insights applicable to other photosynthetic organisms including Ectocarpus) has determined that the midpoint potentials (Em) of the two QB redox couples are approximately: Em(QB/QB- −) ≈ 90 mV and Em(QB- −/QBH2) ≈ 40 mV .

These redox properties have several important implications for electron transport efficiency:

  • The semiquinone (QB- −) is thermodynamically stabilized, with a relatively high potential that minimizes back-reactions and prevents electrons from leaking onto O2, explaining the remarkable stability of QB- −

  • The resulting Em(QB/QBH2) is approximately 65 mV, which is lower than the Em(PQ/PQH2) in the membrane pool (approximately 117 mV). This difference (ΔE ≈ 50 meV) provides the thermodynamic driving force for QBH2 release into the membrane pool

  • The difference between Em(QB/QB- −) and Em(QA/QA- −) (from literature) is approximately 234 meV, which corresponds to the driving force for electron transfer from QA- − to QB

This fine-tuning of redox potentials ensures directional electron flow and minimizes deleterious side reactions, optimizing the efficiency of photosynthetic electron transport.

What methodological approaches are used to measure the midpoint potentials of QB in Photosystem II?

Measuring the midpoint potentials of the QB redox couples requires sophisticated biophysical techniques:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: This is the primary method used to determine the redox potentials of QB. EPR can detect the semiquinone radical (QB- −) and monitor its formation and disappearance as a function of ambient redox potential

  • Potentiometric Titrations: Combined with EPR detection, potentiometric titrations involve adjusting the ambient redox potential using redox mediators while monitoring the formation of QB- −. The resulting titration curves can be fitted to determine the midpoint potentials of the QB/QB- − and QB- −/QBH2 couples

  • Sample Preparation Protocol:

    • PSII samples must be carefully isolated and purified to maintain structural integrity

    • Appropriate redox mediators that equilibrate with the QB site but do not interfere with the EPR signal must be selected

    • The ambient redox potential is typically controlled using ferri/ferrocyanide mixtures and measured with a redox electrode

    • Samples are poised at different potentials, frozen, and then analyzed by EPR spectroscopy

  • Data Analysis: The intensity of the QB- − EPR signal plotted against ambient potential generates titration curves that can be fitted to the Nernst equation to extract the midpoint potentials

This methodological approach requires specialized equipment and expertise but provides valuable thermodynamic information that is essential for understanding PSII function.

How does the stability of the semiquinone (QB- −) intermediate contribute to the efficiency and regulation of PSII?

The semiquinone intermediate (QB- −) in PSII exhibits remarkable stability that is critical for efficient photosynthetic electron transport. Research has revealed several key aspects of this stability:

  • Thermodynamic Stability: The relatively high midpoint potential of the QB/QB- − couple (approximately 90 mV) provides thermodynamic stabilization of the semiquinone state

  • Prevention of Back-Reactions: The energetics of the semiquinone state minimizes back-reactions, preventing electrons from returning to their source and maintaining forward electron flow

  • Protection Against ROS Formation: By minimizing electron leakage onto O2, the stability of QB- − reduces the formation of reactive oxygen species that could damage the photosynthetic apparatus

  • Two-Electron Gate Function: The stability of QB- − enables PSII to function as a two-electron gate, accumulating two successive single-electron reductions before protonation reactions occur, ensuring efficient coupling of electron and proton transfer

  • Protein Environment Contributions: Specific amino acid residues in the QB binding pocket create an environment that stabilizes the semiquinone through hydrogen bonding, electrostatic interactions, and precise positioning relative to other redox-active cofactors

What techniques can be used to investigate potential protein-protein interactions involving Photosystem Q(B) protein in Ectocarpus siliculosus?

Investigating protein-protein interactions involving the Photosystem Q(B) protein requires multiple complementary approaches:

  • Co-Immunoprecipitation: Using antibodies against the Photosystem Q(B) protein to pull down interacting partners, followed by mass spectrometry identification. Similar approaches have been used for other Ectocarpus proteins

  • Yeast Two-Hybrid Screening: Although challenging for membrane proteins, modified versions like membrane yeast two-hybrid (MYTH) can be adapted for identifying interaction partners of the Photosystem Q(B) protein

  • Immunolocalisation with Double Labeling: Using antibodies against both the Photosystem Q(B) protein and potential interaction partners to visualize co-localization. This approach has been successfully employed in Ectocarpus studies, where co-recognition by two different antibodies was used to specifically locate proteins of interest

  • Cross-Linking Mass Spectrometry: Chemical cross-linking of interacting proteins followed by mass spectrometry can identify proteins in close proximity to the Photosystem Q(B) protein

  • FRET/BRET Analysis: For proteins where fluorescent or bioluminescent tagging is possible, these techniques can detect close associations between proteins in vivo

  • Split Fluorescent Protein Complementation: This approach can confirm suspected interactions by bringing together fragments of a fluorescent protein attached to the proteins of interest

When designing such experiments for Ectocarpus siliculosus proteins, researchers should consider the unique cellular environment of brown algae and the potential for cross-reactivity when using antibodies, as has been observed in related studies .

How can recombinant expression systems be optimized for the production of functional Ectocarpus siliculosus Photosystem Q(B) protein?

Optimizing expression systems for membrane proteins like Photosystem Q(B) requires careful consideration of several factors:

  • Selection of Expression System:

    • Bacterial systems (E. coli): May require codon optimization and specialized strains for membrane protein expression

    • Yeast systems (P. pastoris): Often better for eukaryotic membrane proteins with post-translational modifications

    • Algal systems: Consider expression in related algal species that may provide the appropriate cellular machinery

    • Cell-free expression systems: Can be advantageous for difficult membrane proteins

  • Expression Construct Design:

    • Include appropriate fusion tags for purification (His-tag, FLAG-tag, etc.)

    • Consider fusion partners that enhance membrane protein folding and stability

    • Design constructs with optimal codon usage for the expression host

    • Include appropriate promoters and regulatory elements for controlled expression

  • Membrane Protein Extraction and Purification:

    • Use mild detergents suitable for photosynthetic proteins (β-DDM, digitonin)

    • Consider lipid supplementation to maintain protein structure and function

    • Optimize buffer conditions to maintain protein stability (50% glycerol for storage, as used with the commercial protein)

    • Implement quality control measures to verify protein folding and function

  • Functional Verification Methods:

    • Spectroscopic analysis to confirm cofactor binding

    • EPR spectroscopy to verify formation of semiquinone intermediate

    • Binding assays with plastoquinone analogs

    • Reconstitution into liposomes or nanodiscs for functional studies

When expressing recombinant proteins, researchers must balance protein yield with functional quality, as high expression levels often lead to misfolding of complex membrane proteins like Photosystem Q(B).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.