Recombinant Ectopic P granules protein 3 (epg-3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ectopic P Granules Protein 3 (epg-3)

epg-3 is a recombinant protein derived from Caenorhabditis elegans (C. elegans), a nematode model organism widely used in developmental and molecular biology research. It belongs to a conserved family of proteins (epg-2, -3, -4, -5) critical for autophagy, particularly in germ cell maintenance and stress responses . The protein is commercially available as a recombinant product, expressed in E. coli systems and purified for research applications .

ParameterDetails
Source OrganismCaenorhabditis elegans
UniProt IDQ9XWU8
Expression HostE. coli
TagHis-tag (determined during production)
Molecular LengthFull-length (1–458 amino acids)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (long-term), working aliquots at 4°C for ≤1 week

Production and Purification

Recombinant epg-3 is produced via bacterial expression systems, with purification optimized for stability and activity. Key production parameters include:

ParameterDetails
Expression SystemE. coli
Purification MethodAffinity chromatography (His-tag)
Purity>95% (SDS-PAGE verified)
Concentration50 µg/vial (custom concentrations available)

Storage stability is critical: repeated freeze-thaw cycles degrade activity, necessitating aliquoting and -20°C storage .

Functional Role in Biological Processes

epg-3 is essential for autophagy-mediated degradation of P-granule components in C. elegans germ cells. Key roles include:

  1. Autophagy Regulation:

    • Collaborates with epg-4 and epg-5 to drive starvation-induced autophagy .

    • Required for targeting PGL-1/PGL-3 (P-granule markers) to autophagosomes during DNA damage responses .

  2. Germ Cell Maintenance:

    • Prevents ectopic P-granule accumulation in somatic cells during embryogenesis .

    • Facilitates apoptosis in germ cells with DNA damage by clearing PGL-1/PGL-3, enabling CED-4 activation .

Key Studies

Study FocusFindingsSource
DNA Damage ResponseAutophagy (via epg-3) clears PGL-1/PGL-3, enabling apoptosis. epg-3 mutants show reduced germ cell apoptosis.
Autophagy Pathwayepg-3 acts upstream of atg-3 and atg-4 in autophagosome formation.
Genetic InteractionsDepletion of pgl-1/pgl-3 rescues apoptosis defects in epg-3 mutants.

Mechanistic Insights

  • CEP-1 (p53 Homolog) Activation: DNA damage triggers CEP-1 to upregulate autophagy genes, including epg-3 .

  • Synergy with Apoptosis: Autophagy-mediated PGL-1/PGL-3 removal is required for full germ cell apoptosis induction .

Potential Therapeutic and Research Implications

  1. Germline Quality Control: Understanding epg-3-mediated autophagy could inform strategies to eliminate defective germ cells in fertility disorders or cancer.

  2. Neurodegeneration: Autophagy pathways involving epg-3 homologs may offer targets for Alzheimer’s or Parkinson’s, where protein aggregation is implicated .

Technical Considerations for Research Use

  • Assay Optimization: Use recombinant epg-3 in autophagy flux assays or co-IP experiments to study interactions with PGL-1/PGL-3 .

  • Species Specificity: epg-3 homologs in mammals (e.g., EPG5) share conserved functions, enabling cross-species extrapolation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
epg-3; Y37D8A.22; Ectopic P granules protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
epg-3
Target Protein Sequence
MAKKQKKSTEKSERTVEFKEPPKPANSEERLKPAGRGMKPSPSQNTLNRMERETIVFWRR PHIVIPYALMEIAHLAVELFFKILAHKTVLLLTAISIGLAVYGYHAPGAHQEHVQTIEKH ILWWSWWVLLGVLSSIGLGSGLHTFLIYLGPHIAAVTMAAYECQSLDFPQPPYPESIQCP STKSSIAVTFWQIVAKVRVESLLWGAGTALGELPPYFMARAARISGQEPDDEEYREFLEL MNADKESDADQKLSIVERAKSWVEHNIHRLGFPGILLFASIPNPLFDLAGITCGHFLVPF WSFFGATLIGKALVKMHVQMGFVILAFSDHHAENFVKILEKIPAVGPYIRQPISDLLEKQ RKALHKTPGEHSEQSTSYLAWGLSLMVTFMILFFFLSIVNSLAKDYHKRLWERKRRQNKD LIDEENQSFEEEEEEAVTPPSSCPLLLSDGFEGVVVKK
Uniprot No.

Target Background

Function
Involved in autophagy. Believed to play a role in autophagosome and omegasome formation.
Database Links
Protein Families
VMP1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in pharyngeal and body wall muscles and intestine cells.

Q&A

What is EPG-3 and what is its role in C. elegans?

EPG-3 is a protein involved in the autophagy pathway in Caenorhabditis elegans and plays a role in P granule regulation. It belongs to the EPG (Ectopic P Granule) family of proteins that contribute to the proper formation and distribution of germline-specific P granules. Similar to other EPG proteins such as EPG-5, EPG-8, and EPG-9, EPG-3 is likely involved in specific steps of the autophagy process . In the context of C. elegans biology, P granules are germline-specific cytoplasmic structures that are essential for postembryonic germline development through regulation of RNA metabolism. These granules are typically localized at the perinuclear region of germ cells during most developmental stages, associating with clusters of nuclear pores .

How does EPG-3 relate to other P granule components?

EPG-3, as an autophagy regulator, likely influences the dynamics of major P granule components such as PGL-1 and PGL-3. Research has shown that the removal of P granule components like PGL-1 and PGL-3 from germ cells is autophagy-dependent and occurs prior to germ cell apoptosis . While EPG-3's specific interactions are not detailed in the available data, other research shows that P granules contain various factors including CGH-1, CAR-1, and DCAP-2, which are also components of P body-like structures . This suggests that EPG-3 functions within a complex network of proteins that regulate P granule integrity and function in response to cellular stresses such as DNA damage.

What experimental techniques are commonly used to study EPG-3?

The study of EPG-3 typically employs several complementary techniques:

  • Genetic analysis: Using mutant strains (e.g., epg-3 deletion or point mutations) to assess phenotypic consequences

  • Fluorescence microscopy: Examining the localization and dynamics of fluorescently tagged EPG-3 and its co-localization with other P granule components

  • Immunoprecipitation: Investigating protein-protein interactions between EPG-3 and other autophagy or P granule proteins

  • RNA interference (RNAi): Depleting EPG-3 to assess its function through loss-of-function phenotypes

Similar to studies on other autophagy genes in C. elegans, these techniques would help determine how EPG-3 contributes to P granule dynamics and autophagy processes. Research on related proteins has used time-lapse observations of autophagy markers like LGG-1 (a homolog of mammalian LC3) to track autophagy activation and progression .

How should researchers prepare recombinant EPG-3 for functional studies?

For the preparation of recombinant EPG-3:

  • Expression system selection: E. coli BL21(DE3) is typically recommended for expression of C. elegans proteins, though insect cell systems may provide better folding for complex proteins

  • Vector design: Include a cleavable tag (His6 or GST) for purification purposes

  • Optimization of expression conditions: Test varying IPTG concentrations (0.1-1.0 mM), temperatures (16-37°C), and expression times (3-24h)

  • Purification protocol:

    • Lysis in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, and protease inhibitors

    • Affinity chromatography using Ni-NTA or glutathione resin

    • Size exclusion chromatography for final purification

  • Quality control: Verify purity by SDS-PAGE (>95%) and confirm functionality through in vitro assays

When designing experiments using recombinant EPG-3, researchers should include appropriate controls and ensure sufficient replication. Generally, experimental designs should include 15-20 replicates per treatment to achieve adequate statistical power, as recommended for other complex biological systems .

How does EPG-3 function in the context of stress-induced autophagy pathways?

EPG-3 likely plays a specialized role in stress-induced autophagy, particularly in response to DNA damage. Based on studies of related EPG proteins, we can infer that EPG-3 may be transcriptionally regulated by CEP-1 (the C. elegans p53 homolog) following DNA damage . The autophagy pathway in C. elegans involves several distinct steps:

  • Induction (involving proteins like ATG-13 and ATG-9)

  • Nucleation (involving proteins like EPG-8)

  • Elongation (involving proteins like ATG-3, ATG-4.1, and ATG-4.2)

  • Retrieval (involving proteins like ATG-2 and ATG-18)

  • Additional steps involving proteins like EPG-5 and EPG-9

EPG-3 might function at a specific stage of this process, contributing to the selective autophagy of P granule components. This selective degradation is critical for cellular responses to stress, as autophagy mutants show defects in DNA damage-induced germ cell apoptosis that can be bypassed by depleting P granule components . Researchers investigating EPG-3's role should consider designing experiments that examine its function across these distinct autophagy stages using appropriate markers for each phase.

What are the experimental challenges in distinguishing EPG-3's role from other EPG family proteins?

Distinguishing EPG-3's unique functions presents several experimental challenges:

  • Functional redundancy: EPG family proteins may have overlapping functions, requiring combinatorial mutations or depletions to reveal phenotypes

  • Temporal dynamics: EPG-3 may act at specific developmental stages or stress conditions, necessitating precisely timed observations

  • Subcellular resolution: Determining the exact subcellular localization requires super-resolution microscopy to distinguish between different P body-like structures (e.g., grP bodies versus dcP bodies)

  • Protein interaction networks: EPG-3 likely functions within complex protein interaction networks that may compensate for its loss

To address these challenges, researchers should implement:

  • CRISPR/Cas9-mediated tagging of endogenous EPG-3 to avoid overexpression artifacts

  • Temperature-sensitive or degron-tagged EPG-3 variants for temporal control

  • Quantitative interaction proteomics to map the complete EPG-3 interactome

  • Careful genetic analysis using double or triple mutants with other autophagy genes

Such approaches would help delineate EPG-3's specific contributions to autophagy and P granule regulation.

How can researchers effectively measure EPG-3-mediated autophagy of P granule components?

To quantitatively assess EPG-3's role in P granule component autophagy, researchers should employ multiple complementary approaches:

  • Fluorescence-based assays:

    • Dual-fluorescent reporters to track PGL-1 and PGL-3 degradation

    • Co-localization analysis with autophagy markers like LGG-1 (C. elegans LC3 homolog)

    • FRAP (Fluorescence Recovery After Photobleaching) to measure P granule dynamics

  • Biochemical quantification:

    • Western blotting to measure PGL-1 and PGL-3 protein levels in wild-type versus epg-3 mutants

    • Immunoprecipitation to detect ubiquitination of P granule components

    • Density gradient fractionation to separate intact P granules from components being degraded

  • Time-resolved analysis:

    • Live imaging using time-lapse microscopy to track the sequence of events following DNA damage

    • Synchronization of autophagy induction using UV irradiation protocols as established for studying related processes

These approaches should be implemented with appropriate statistical analysis, including 15-20 replicates per condition to account for the high variability typical in such biological systems .

What is the relationship between EPG-3 and the regulation of maternal mRNAs in P granules?

EPG-3 likely contributes to the dynamic regulation of maternal mRNAs through its effects on P granule integrity. P granules and related structures are known to be critical sites for maternal mRNA regulation in the C. elegans germline . The relationship may include:

  • Selective mRNA targeting: EPG-3-mediated autophagy may selectively degrade P granules containing specific maternal mRNAs

  • Translational control: By affecting P granule composition, EPG-3 may influence the translational repression of maternal mRNAs

  • RNP granule transitions: EPG-3 may facilitate transitions between different types of RNP granules (grP bodies, dcP bodies, and canonical P bodies)

To investigate these relationships, researchers should:

  • Perform RNA immunoprecipitation followed by sequencing (RIP-seq) to identify mRNAs affected by EPG-3 depletion

  • Use single-molecule FISH to track specific maternal mRNAs in wild-type versus epg-3 mutant backgrounds

  • Employ polysome profiling to assess translational status of maternal mRNAs in the presence or absence of EPG-3

These approaches would help elucidate how EPG-3-mediated autophagy contributes to post-transcriptional gene regulation in the germline.

What controls are essential when studying EPG-3 function in C. elegans?

When designing experiments to investigate EPG-3 function, the following controls are essential:

  • Genetic controls:

    • Wild-type N2 strain as baseline

    • Known autophagy mutants (e.g., atg-13, atg-9, atg-4.1) for comparison

    • Single and double mutants with other epg genes to assess redundancy

    • Rescue lines expressing wild-type EPG-3 in epg-3 mutant background

  • Experimental controls:

    • Non-stressed conditions alongside DNA damage treatments

    • Temperature controls (20°C standard, with variations if using temperature-sensitive alleles)

    • Age-matched animals (typically synchronized L4 or young adult hermaphrodites)

    • Mock RNAi treatments when using RNA interference

  • Technical controls:

    • Multiple independent transgenic lines when using fluorescent tags

    • Antibody specificity controls for immunostaining

    • Loading controls for Western blot analysis

Proper randomization is also critical, ensuring that replicates of different treatments are equally represented throughout the duration of the experiment to control for any environmental variations .

How can researchers address EPG-3 expression level variability in experimental systems?

Addressing variability in EPG-3 expression requires systematic approaches:

  • Endogenous tagging: Use CRISPR/Cas9 to tag endogenous EPG-3, avoiding overexpression artifacts from transgenic arrays

  • Single-copy integration: When exogenous expression is necessary, use MosSCI or miniMos techniques for controlled, single-copy integration

  • Quantitative methods: Implement qPCR for mRNA levels and quantitative Western blotting for protein levels

  • Statistical considerations:

    • Power analysis to determine appropriate sample sizes (minimum 15-20 replicates recommended)

    • Mixed-effects statistical models to account for between-batch variability

    • Normalized reporting of expression relative to housekeeping genes or proteins

Additionally, researchers should consider creating a standardized EPG-3 expression construct with well-characterized promoters and 3' UTRs to enable cross-laboratory comparisons and reproducibility.

What optimization strategies are recommended for EPG-3 immunoprecipitation experiments?

For successful EPG-3 immunoprecipitation experiments, consider these optimization strategies:

  • Lysis conditions:

    • Test multiple lysis buffers (RIPA, NP-40, Triton X-100) with varying salt concentrations (150-500 mM)

    • Include protease inhibitors, phosphatase inhibitors, and deubiquitinase inhibitors

    • Optimize sonication parameters to preserve protein-protein interactions

  • Antibody selection:

    • Use multiple antibodies targeting different EPG-3 epitopes when available

    • Consider epitope-tagged versions (FLAG, HA, V5) if specific antibodies are unavailable

    • Validate antibody specificity using epg-3 null mutants

  • Interaction stabilization:

    • Use cross-linking agents (formaldehyde, DSS) for transient interactions

    • Test detergent-free buffers for membrane-associated complexes

    • Include ATP and GTP (1 mM each) to preserve nucleotide-dependent interactions

  • Controls and validation:

    • Include IgG control immunoprecipitations

    • Validate interactions by reciprocal co-immunoprecipitation

    • Confirm biological relevance through functional assays

These approaches should help capture both stable and transient interactions of EPG-3, providing insight into its functional protein network.

How should researchers resolve contradictory data regarding EPG-3 function?

When facing contradictory data about EPG-3 function, researchers should:

  • Systematic evaluation:

    • Compare experimental conditions (temperature, developmental stage, stress conditions)

    • Assess genetic backgrounds for potential modifier effects

    • Evaluate reagent specificity (antibodies, RNAi constructs)

  • Reconciliation approaches:

    • Perform epistasis analysis to place contradictory functions in a pathway context

    • Consider tissue-specific or temporal contexts that might explain different results

    • Develop quantitative models that incorporate seemingly contradictory data

  • Validation strategies:

    • Use orthogonal techniques to confirm observations

    • Generate allelic series of mutations to detect hypomorphic effects

    • Perform rescue experiments with structure-function analysis

  • Collaborative resolution:

    • Exchange reagents and protocols between laboratories reporting contradictory results

    • Conduct blind replication studies with standardized protocols

This structured approach helps distinguish genuine biological complexity from technical artifacts.

What statistical approaches are most appropriate for analyzing EPG-3-related phenotypes?

For analyzing EPG-3-related phenotypes, consider these statistical approaches:

  • For quantitative measurements:

    • Linear mixed-effects models to account for batch effects and repeated measures

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

  • For categorical or count data:

    • Chi-square or Fisher's exact tests for categorical variables

    • Poisson or negative binomial regression for count data (e.g., number of P granules)

    • Logistic regression for binary outcomes

  • For time-course experiments:

    • Survival analysis techniques for time-to-event data

    • Repeated measures ANOVA or linear mixed models

    • Functional data analysis for continuous trajectories

  • Sample size considerations:

    • Minimum of 15-20 replicates per treatment for adequate statistical power

    • Power analysis based on preliminary data to determine optimal sample sizes

    • Correction for multiple testing when examining numerous parameters

Proper statistical analysis should be integrated into the experimental design phase rather than applied post hoc to ensure sufficient power to detect biologically meaningful effects.

How can researchers effectively integrate EPG-3 findings with the broader autophagy and P granule literature?

To effectively integrate EPG-3 research with the broader literature:

  • Systematic mapping:

    • Construct interaction networks including known autophagy and P granule components

    • Perform comparative analysis across model organisms (yeast, Drosophila, mammals)

    • Consider evolutionary conservation of EPG-3 structure and function

  • Integrative approaches:

    • Combine genetic, biochemical, and cell biological data using Bayesian networks

    • Develop mathematical models of autophagy that incorporate EPG-3 function

    • Use ontology frameworks to standardize phenotypic descriptions

  • Contextual analysis:

    • Examine EPG-3 function across different stressors (DNA damage, starvation, proteotoxic stress)

    • Compare EPG-3 mechanisms with those regulating other RNA granules (stress granules, P bodies)

    • Consider developmental context, particularly germline versus somatic functions

This integrative approach allows researchers to position EPG-3 findings within the broader conceptual framework of autophagy regulation and RNA granule dynamics.

What are the implications of EPG-3 research for understanding selective autophagy mechanisms?

EPG-3 research has significant implications for understanding selective autophagy:

  • Cargo recognition mechanisms:

    • EPG-3 may represent a specialized adapter for P granule component recognition

    • Understanding how EPG-3 distinguishes between different P granule components could reveal general principles of autophagy substrate selection

    • The relationship between EPG-3 and ubiquitin-dependent vs. ubiquitin-independent cargo selection pathways

  • Stress-responsive regulation:

    • How DNA damage signaling through CEP-1 (p53 homolog) activates EPG-3-dependent autophagy

    • Potential integration of multiple stress signals (oxidative stress, nutrient limitation, DNA damage)

    • Temporal coordination of autophagy with other stress responses

  • Relationship to other selective autophagy pathways:

    • Connections to mitophagy, aggrephagy, and other selective autophagy pathways

    • Common regulatory mechanisms versus pathway-specific components

    • Evolution of selectivity in autophagy systems across phylogeny

Understanding EPG-3's precise role would help elucidate how cells achieve specificity in their autophagic responses to different stressors.

How might EPG-3 function relate to human disease mechanisms?

EPG-3's functions may have important implications for human disease mechanisms:

  • Neurodegenerative diseases:

    • Many neurodegenerative diseases involve defects in autophagy and RNA granule dynamics

    • Understanding EPG-3 function may provide insights into pathological RNA granule formation in conditions like ALS and frontotemporal dementia

    • Potential therapeutic strategies targeting the human orthologs of EPG-3

  • Cancer biology:

    • The relationship between DNA damage, autophagy, and cell death is central to cancer treatment

    • EPG-3-like functions may influence cancer cell survival following genotoxic therapies

    • Selective autophagy of RNA-processing bodies could affect cancer cell adaptation to stress

  • Reproductive disorders:

    • Given P granules' importance in germline development, human orthologs of EPG-3 might influence fertility

    • Maternal effect mutations might affect early embryonic development

    • Stress responses in germline cells could impact gamete quality

Translational research should focus on identifying the human orthologs of EPG-3 and characterizing their functions in health and disease contexts.

What cutting-edge techniques are advancing the study of EPG-3 and related proteins?

Several cutting-edge techniques are revolutionizing EPG-3 research:

  • Advanced imaging approaches:

    • Lattice light-sheet microscopy for long-term, low-phototoxicity imaging of P granule dynamics

    • Super-resolution microscopy (STORM, PALM) to resolve substructures within P granules

    • Correlative light and electron microscopy (CLEM) to visualize autophagosomes capturing P granule components

  • Proximity labeling techniques:

    • TurboID or APEX2 fused to EPG-3 to identify neighboring proteins in living cells

    • Spatially-restricted enzymatic tagging to distinguish different pools of EPG-3

    • Time-resolved proximity labeling to capture dynamic interaction changes after stress

  • Synthetic biology approaches:

    • Optogenetic control of EPG-3 activity to precisely trigger autophagy of P granules

    • Engineered allosteric switches to modulate EPG-3 function

    • Synthetic reconstitution of minimal EPG-3-dependent autophagy systems

  • Single-cell technologies:

    • Single-cell RNA-seq to capture cell-to-cell variability in responses to EPG-3 perturbation

    • Single-molecule tracking to follow individual EPG-3 proteins in living cells

    • CUT&RUN or CUT&Tag to map transcription factor binding at EPG gene loci

These advanced techniques offer unprecedented resolution and control for studying EPG-3 biology.

How can researchers develop more physiologically relevant models for studying EPG-3 function?

To develop more physiologically relevant models for EPG-3 research:

  • Tissue-specific approaches:

    • Germline-specific expression systems that maintain physiological levels

    • Microfluidic devices for precise control of worm positioning and environmental conditions

    • Organoid systems derived from pluripotent stem cells expressing tagged EPG-3 orthologs

  • Environmental relevance:

    • Incorporation of naturalistic stressors (temperature cycling, intermittent food availability)

    • Microbial exposures that mimic natural C. elegans habitats

    • Multi-generational studies to assess epigenetic effects

  • Physiological readouts:

    • Measurement of reproductive fitness as the ultimate phenotypic readout

    • Integration of behavioral phenotyping with molecular and cellular analyses

    • Metabolomic profiling to connect EPG-3 function to broader physiological states

These approaches help bridge the gap between molecular mechanisms and organismal phenotypes, providing context for understanding EPG-3's biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.