Recombinant Ectopic P granules protein 4 (epg-4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant EPG-4

Recombinant EPG-4 is expressed in E. coli with an N-terminal His tag for purification. Key properties include:

PropertyDetails
UniProt IDQ20123
SpeciesCaenorhabditis elegans
Protein LengthFull-length (1-315 amino acids)
Molecular Weight~35 kDa (theoretical)
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

The amino acid sequence features conserved domains involved in protein-protein interactions and membrane association .

Biological Role in Autophagy and Germ Granule Dynamics

EPG-4 is a key component of the autophagy machinery required for the degradation of P granules, germline-specific ribonucleoprotein (RNP) condensates in C. elegans. Key findings include:

Autophagy Pathway Involvement

EPG-4 functions in the elongation step of autophagosome formation, interacting with other autophagy-related (ATG) proteins :

C. elegans GeneMammalian HomologFunctionReferences
epg-4EI24Autophagic degradation of P granules
bec-1BECN1Autophagy initiation
lgg-1GABARAPLC3 lipidation

P Granule Regulation

  • Physiological Role: P granules regulate RNA metabolism in germ cells. EPG-4 mediates their autophagic turnover during stress or apoptosis .

  • DNA Damage Response: EPG-4-dependent autophagy removes PGL-1/PGL-3 (core P granule proteins) to promote germ cell apoptosis upon UV irradiation .

  • Phase Separation: EPG-11 (PRMT1 homolog) methylates PGL-1/PGL-3, destabilizing aggregates. EPG-4 counteracts this by facilitating autophagic clearance .

Functional Studies

  • Autophagy Mutants: epg-4 mutants exhibit impaired PGL-1/PGL-3 removal, leading to reduced germ cell apoptosis under DNA damage .

  • Interactions: EPG-4 collaborates with scaffold protein EPG-2 and methyltransferase EPG-11 to regulate granule dynamics .

Recombinant Protein Utility

Recombinant EPG-4 is widely used to:

  • Study autophagy mechanisms in C. elegans .

  • Develop antibodies for Western blot and ELISA .

  • Investigate phase separation defects in neurodegenerative disease models .

Comparative Analysis of EPG-4 Homologs

EPG-4 is evolutionarily conserved, with functional parallels in mammals:

OrganismHomologFunctionReferences
C. elegansEPG-4P granule autophagy
HumanEI24ER-phagy, tumor suppression
MouseEI24Mitochondrial quality control

Technical Considerations for Recombinant EPG-4

  • Stability: Lyophilized form retains activity for 12 months at -80°C; repeated freeze-thaw cycles degrade functionality .

  • Activity Assays: LGG-1 (LC3 homolog) foci formation assays validate autophagy induction in C. elegans .

  • Cross-Reactivity: Anti-EPG-4 antibodies show specificity for C. elegans but not mammalian EI24 .

Future Directions

Current research focuses on:

  • Elucidating EPG-4’s role in phase separation regulation.

  • Developing EPG-4 inhibitors to modulate autophagy in disease models.

  • Exploring cross-species functional conservation with EI24 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
epg-4; eip-24; F37C12.2; Ectopic P granules protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
epg-4
Target Protein Sequence
MVKFQIIARDFYHGFIDSFKGITFVRRIREEEAKEVKVEPPKPVERTVLMMRREKQGIFK RPPEPPKKKDSFLKKLWQIYAMNIGFLVLWQVCILILGLFFSFFDRTDLGHNIGYILIIP IFFASRIIQALWFSDISGACMRALKLPPPPVVPFSSMLAGTLISALHQIFFLIQGMLSQY LPIPLITPVIVYLHMALLNSMYCFDYFFDGYNLSFLRRKDIFESHWPYFLGFGTPLALAC SISSNMFVNSVIFALLFPFFIITSYPANWNRKYEEEIPKIAFCRISYMFTELVGKFVKSI TPTNNPTAARNNAQN
Uniprot No.

Target Background

Function
Recombinant Ectopic P granules protein 4 (epg-4) plays a role in autophagy. It is believed to participate in autophagasome and omegasome formation.
Database Links
Protein Families
EI24 family
Subcellular Location
Cytoplasm. Membrane; Multi-pass membrane protein. Note=Forms a reticular pattern throughout the cytoplasm.
Tissue Specificity
Expressed in pharyngeal and body wall muscles and intestine cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.