Recombinant Edwardsiella ictaluri Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; NT01EI_1674; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
clsA
Target Protein Sequence
MSTFYTVISWLAIFGYWLLIASVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARTMWPSTARWLADLRSCRSIFATHNSEVAAPLFQLCERRQGIAGVKGNQ LQLLTSTDDTLNALIRDIELAHTSIEMMFYIWQPGGLADRVAEAMMAAARRGIRCRLMLD SAGSVAFFRSPYPAMMREAGIEVVEALQVNLLRVFLRRMDLRQHRKVVLIDNFIAYTGSM NLVDPRYFKQDAGVGQWIDVMARMEGPVATTMGIYYAFDWEMETGKRILPPEPICNILPF EKESGHTIQVIASGPGFPEELIHQSLLTAVYSARQQLVMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPKKNDSMMVGWASRAFFTEMLAAGVKIYQFEGGLLHTKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGSDLACVQEDYIARSSLLDPLEWLKRPLWQRVVERLFY FFSPLL
Uniprot No.

Target Background

Function
This recombinant *Edwardsiella ictaluri* cardiolipin synthase (cls) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, forming cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary biochemical function of Cardiolipin synthase in bacterial membranes?

Cardiolipin synthase (cls) catalyzes the formation of cardiolipin (CL), a key phospholipid in bacterial membranes. In most bacteria including E. ictaluri, the primary reaction involves the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol. This reaction follows the pathway:

Phosphatidic acid (PA) → CDP-diacylglycerol (CDP-DAG) → Phosphatidylglycerophosphate (PGP) → Phosphatidylglycerol (PG) → Cardiolipin (CL)

The final step catalyzed by cls is a phosphatidyl transfer from one PG molecule to a second PG molecule. Cardiolipin typically constitutes 5-15% of bacterial membrane phospholipids, with the remainder being primarily phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) .

What are the optimal conditions for recombinant expression of E. ictaluri Cardiolipin synthase?

For successful expression of recombinant E. ictaluri Cardiolipin synthase:

  • Expression System: E. coli is the most commonly used host for recombinant cls expression, though cell-free expression systems are also viable alternatives .

  • Construct Design: The full-length protein (1-486 amino acids) can be expressed with an N-terminal His-tag for purification purposes. The gene of interest (NT01EI_1674) should be codon-optimized for the expression host .

  • Induction Parameters: Due to potential toxicity when overexpressed (similar to ClsA in E. coli), low induction conditions are recommended to maintain cell viability .

  • Buffer Optimization: Tris-based buffers with 6% trehalose at pH 8.0 have been shown to maintain protein stability .

ParameterRecommended Condition
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull length (1-486aa)
BufferTris/PBS-based, 6% Trehalose, pH 8.0
Storage-20°C/-80°C with 50% glycerol

What purification strategy yields the highest purity and activity for recombinant E. ictaluri cls?

A multi-step purification approach is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged cls protein.

  • Secondary Purification: Size exclusion chromatography to remove aggregates and achieve >90% purity as determined by SDS-PAGE .

  • Concentration and Storage: The purified protein should be concentrated to 0.1-1.0 mg/mL and stored in buffer containing 50% glycerol to prevent freeze-thaw damage.

  • Aliquoting Strategy: Small working aliquots should be prepared to avoid repeated freeze-thaw cycles, with short-term storage at 4°C (up to one week) and long-term storage at -20°C/-80°C .

How does E. ictaluri Cardiolipin synthase differ from other bacterial Cls enzymes?

While E. ictaluri cls shows structural similarities to other bacterial cardiolipin synthases, there are notable differences in the enzymatic mechanisms across bacterial species:

  • Multiple Cls Isoforms: In E. coli, three distinct cardiolipin synthases have been identified (ClsA, ClsB, and ClsC), each with specific roles during different growth phases and environmental conditions. E. ictaluri appears to possess a single cls gene that may incorporate functions of multiple cls isoforms .

  • Substrate Specificity: Unlike the ClsC of E. coli, which uses phosphatidylethanolamine (PE) as the phosphatidyl donor to phosphatidylglycerol (PG), E. ictaluri cls likely follows the more common bacterial pathway using two PG molecules as substrates .

  • Osmotic Regulation: Expression data suggests that like E. coli ClsA, E. ictaluri cls activity may be increased with increasing medium osmolarity during logarithmic growth and in stationary phase .

  • Membrane Localization: Studies of related bacterial cls enzymes show that ClsA is N-terminally processed and membrane-anchored, with dual, cytoplasmic, catalytic domains. Mutations in the active site (H224A and H404A in E. coli ClsA) inactivate the enzyme .

What is the relationship between Cardiolipin synthase activity and pathogenicity in E. ictaluri?

The relationship between cls activity and E. ictaluri virulence appears to be multifaceted:

  • Membrane Composition and Stress Response: Cardiolipin constitutes a significant portion of bacterial membranes and plays a role in adapting to environmental stresses encountered during infection. In E. ictaluri, which causes enteric septicemia of catfish (ESC), membrane composition likely influences survival within macrophages .

  • Virulence Regulation Network: In the related species E. piscicida, the fatty acid regulator FabR modulates both fatty acid composition and virulence. FabR binds to the promoter region of the virulence regulator esrB, facilitating expression of the type III secretion system (T3SS) in response to unsaturated fatty acids. This suggests a potential connection between membrane lipid metabolism (including cardiolipin synthesis) and virulence mechanisms .

  • Intracellular Survival: E. ictaluri forms Edwardsiella-containing vacuoles (ECVs) within host macrophages, avoiding phagosomal/lysosomal fusion and suppressing programmed cell death. Membrane composition, potentially including cardiolipin distribution, may be critical for this process .

  • Co-localization with Virulence Factors: Studies in related systems show that cardiolipin and cls can colocalize with other bacterial proteins at cell poles, potentially contributing to protein function and localization. This spatial organization may be important for virulence factor deployment .

What assays can be used to measure E. ictaluri Cardiolipin synthase activity in vitro?

Several complementary approaches can be used to assess cls activity:

  • Radioisotope-Based Assays: Using 14C-labeled phosphatidylglycerol as substrate and measuring the formation of radioactive cardiolipin by thin-layer chromatography (TLC).

  • Mass Spectrometry Analysis: Liquid chromatography-mass spectrometry (LC-MS) can be used to directly measure the conversion of PG to cardiolipin and quantify the reaction products without radioactive labeling.

  • Fluorescent Substrate Analogs: Fluorescently labeled phospholipids can be used as substrates, with activity measured through changes in fluorescence properties.

  • Enzyme-Coupled Assays: Measuring the release of glycerol (the other product of the cls reaction) using glycerol kinase and glycerol-3-phosphate dehydrogenase with spectrophotometric detection of NADH oxidation.

  • Activity Validation: Confirm enzymatic dependence by testing mutations in the conserved HKD motifs (as demonstrated with E. coli ClsA where H224A and H404A mutations inactivated the enzyme) .

How can researchers investigate the subcellular localization of E. ictaluri Cardiolipin synthase?

To study the subcellular localization of E. ictaluri cls:

  • Fluorescent Protein Fusions: Creating cls-GFP (or other fluorescent protein) fusions for live-cell imaging. Care must be taken with fusion placement to avoid disrupting membrane integration or enzymatic activity.

  • Immunofluorescence Microscopy: Using specific antibodies against cls for fixed-cell imaging, potentially with co-staining for membrane markers.

  • Membrane Fractionation: Biochemical separation of bacterial membrane fractions followed by Western blotting to detect cls location.

  • Cardiolipin Detection: The lipophilic dye 10-N-nonyl acridine orange (NAO) binds specifically to cardiolipin and can be used to correlate cls localization with its product distribution.

  • Bacterial Two-Hybrid System (BACTH): As used with E. coli ClsA, BACTH can identify potential protein interactions that may indicate cls localization partners. Studies in E. coli identified interactions between ClsA and proteins like YdhP and YjbJ, which may suggest similar interactions in E. ictaluri .

What genetic approaches can be used to study E. ictaluri cls function in vivo?

Several genetic strategies can elucidate cls function:

  • Gene Knockout/Knockdown: Creating a cls deletion mutant to study the physiological impact on membrane composition, stress response, and virulence. Complementation studies should be performed to confirm phenotype specificity.

  • Site-Directed Mutagenesis: Introducing specific mutations in the catalytic HKD motifs to create catalytically inactive variants that can be used to study enzyme structure-function relationships.

  • Reporter Gene Fusions: Creating transcriptional fusions (cls promoter driving reporter gene expression) to study gene regulation under various conditions, particularly during infection models.

  • Inducible Expression Systems: Developing conditional expression systems to control cls levels and study the dosage effect on bacterial physiology.

  • In vivo Infection Models: Using catfish infection models with wild-type and cls mutant strains to assess the impact on virulence and host-pathogen interactions .

How might E. ictaluri Cardiolipin synthase be exploited as a potential antimicrobial target?

E. ictaluri cls represents a potential antimicrobial target for several reasons:

  • Essential Membrane Function: Cardiolipin is essential for proper bacterial membrane function, particularly under stress conditions encountered during infection.

  • Structural Uniqueness: The bacterial cardiolipin synthesis pathway differs from eukaryotic pathways, offering selectivity for targeted inhibition. While eukaryotic Cls uses CDP-diacylglycerol and PG as substrates, bacterial enzymes typically use two PG molecules .

  • Targeting Approaches:

    • Small molecule inhibitors designed against the catalytic HKD motifs

    • Peptide inhibitors that disrupt cls membrane localization

    • Compounds that interfere with cls-protein interactions critical for function

  • Combination Therapy: Cls inhibitors might enhance the efficacy of existing antibiotics by destabilizing bacterial membranes, particularly those that target cell envelope integrity.

  • Aquaculture Applications: Given E. ictaluri's importance as a catfish pathogen, cls inhibitors could have significant applications in aquaculture disease management .

What is the relationship between E. ictaluri Cardiolipin synthase and membrane organization during infection?

The role of cls in membrane organization during infection is an emerging area of research:

  • Membrane Microdomains: Cardiolipin can create specialized membrane domains with distinct physical properties. In E. ictaluri, these domains may concentrate virulence factors or defensive proteins at specific cellular locations.

  • Host-Pathogen Interface: During formation of Edwardsiella-containing vacuoles (ECVs), membrane composition likely plays a critical role in determining interactions with host cellular machinery. E. ictaluri modifies its vacuolar environment to avoid phagosomal/lysosomal fusion and suppress host cell death mechanisms .

  • Environmental Adaptation: Cls activity may be modulated in response to host environments, including changes in pH, osmolarity, and antimicrobial peptides encountered during infection.

  • Protein Localization: Similar to E. coli, where ClsA colocalizes with cardiolipin at cell poles and affects the localization of the osmosensing protein ProP, E. ictaluri cls may influence the localization and function of multiple membrane proteins critical for virulence .

  • Experimental Approaches: Advanced microscopy techniques like super-resolution microscopy combined with specific lipid probes could help elucidate the dynamic organization of cardiolipin domains during infection processes.

What are the recommended storage conditions for recombinant E. ictaluri Cardiolipin synthase?

The optimal storage conditions for maintaining activity and stability of recombinant E. ictaluri Cardiolipin synthase (cls) are critical for research applications:

  • Long-term Storage: Store at -20°C/-80°C as a lyophilized powder or in solution with 50% glycerol .

  • Working Aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise protein integrity .

  • Buffer Composition: Tris/PBS-based buffer at pH 8.0 containing 6% trehalose has been demonstrated to maintain protein stability .

  • Reconstitution Protocol: When using lyophilized protein, briefly centrifuge the vial prior to opening. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 50% .

  • Stability Considerations: Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce enzyme activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.