Edwardsiella ictaluri is a Gram-negative, facultative intracellular bacterium that poses a significant threat to the catfish aquaculture industry by causing enteric septicemia of catfish (ESC) . The Rnf complex, a novel ion-motive electron transport chain, couples cellular ferredoxin to the pyridine nucleotide pool . Recombinant Edwardsiella ictaluri Electron Transport Complex Protein RnfG (RnfG) is a component of this complex .
| Category | Description |
|---|---|
| Full Name | Recombinant Full Length Edwardsiella ictaluri Electron transport complex protein RnfG(rnfG) Protein |
| Source | Edwardsiella ictaluri |
| Protein Names | Electron transport complex protein RnfG |
| Gene Names | rnfG |
| Ordered Locus Names | NT01EI_2090 |
| Expression Region | 1-209 |
| AA Sequence | mLTTMRRHGIRLALFAILATALTAIVHQLTTRTIAHQAALQQQRLFDQVIAPDGYDNDLQ RSCLLLRDPRLGDSSAHRLYLAQRQGQPIAALVETTAPDGYAGAIRLLVGADFSGKVLGV RVQEQHETPGLGDKIEIRISDWIDSFRNKVVHGAQDPAFRVKKDGGEFDQFTGATITPRA VVNAVRRTTLAIRDIRPHLASLPRCGESK |
The Rnf complex is a membrane-bound, Na+-translocating ferredoxin:NAD+ oxidoreductase . It facilitates microbial adaptation to diverse environmental conditions by coupling the cellular ferredoxin to the pyridine nucleotide pool .
E. ictaluri employs various secretion systems that contribute to its virulence . Research has identified several virulence factors in E. ictaluri, including the hcp, fldA, wzx, fhuC, and ureE genes, all of which were found in the tested isolates . The presence of the eseJ and traD genes varied among isolates, indicating genetic diversity within E. ictaluri populations .
The type III secretion system (T3SS) in E. ictaluri is regulated by the EsrAB two-component system . This system is essential for virulence, and its expression is influenced by environmental conditions such as low pH and phosphate limitation, mimicking the phagosomal environment .
The RNA chaperone Hfq plays a multifaceted role in E. ictaluri and significantly impacts bacterial growth . Deletion of hfq results in a reduced growth rate during the late exponential phase, highlighting its importance in the bacterium's life cycle .
Genetic diversity among E. ictaluri isolates indicates that populations circulating in specific regions have changed over time . Isolates recovered between 2001 and 2011 showed different genetic characteristics compared to those recovered after 2017 .
KEGG: eic:NT01EI_2090
STRING: 634503.NT01EI_2090
The RnfG protein (rnfG) is a component of the electron transport complex in Edwardsiella ictaluri, a Gram-negative facultative intracellular bacterium that causes enteric septicemia in catfish (ESC). The protein functions as part of the ion-translocating oxidoreductase complex, specifically as the subunit G of the Rnf electron transport complex . This complex plays a crucial role in energy metabolism of the bacterium, contributing to its survival and pathogenicity mechanisms within the host environment.
While the search results don't directly discuss RnfG's specific relationship to other virulence factors, we can contextualize it within E. ictaluri's pathogenic mechanisms. E. ictaluri employs multiple virulence factors including those involved in iron acquisition systems, which are essential during infection . As a component of an electron transport complex, RnfG likely contributes to energy production necessary for virulence expression. Other documented virulence factors in E. ictaluri include the RNA chaperone Hfq, which facilitates gene regulation via small RNAs and affects bacterial growth, motility, biofilm formation, stress response, and virulence in catfish .
For optimal preservation of recombinant RnfG protein stability and activity, adhere to the following conditions:
| Storage Parameter | Recommended Condition |
|---|---|
| Storage Temperature | -20°C to -80°C for long-term storage |
| Working Storage | 4°C for up to one week |
| Physical Form | Lyophilized powder (as supplied) |
| Reconstitution Buffer | Deionized sterile water |
| Recommended Concentration | 0.1-1.0 mg/mL |
| Cryoprotectant | Add glycerol to 5-50% final concentration |
| Default Glycerol Concentration | 50% |
| pH | Storage buffer at pH 8.0 (Tris/PBS-based) |
| Freeze-Thaw Cycles | Avoid repeated freeze-thaw cycles |
Before opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, aliquot the protein to minimize repeated freeze-thaw cycles which can compromise protein integrity .
When designing experiments to investigate RnfG's role in E. ictaluri pathogenesis, consider implementing the following methodological approaches:
Gene Deletion Studies: Create an in-frame deletion mutant of the rnfG gene (EiΔrnfG) using techniques similar to those employed for hfq or tonB deletion in E. ictaluri . This would typically involve:
Constructing a suicide plasmid containing upstream and downstream regions of the rnfG gene
Transferring the plasmid into E. ictaluri via conjugation
Selecting for plasmid integration using appropriate antibiotics
Allowing for the second allelic exchange and selecting with sucrose
Confirming deletion using PCR and sequencing
Phenotypic Characterization:
Growth kinetics in both iron-replete and iron-depleted conditions
Stress response assays (acidic, oxidative stress)
Motility assays
Biofilm formation capacity
Macrophage survival assays using catfish peritoneal macrophages
In vivo Virulence Assessment:
Infection model using catfish to assess bacterial persistence
Comparative survival rates between wild-type and mutant strains
Potential protective effects of attenuated strains against subsequent wild-type infection
Expression Analysis:
Measure rnfG expression under various in vitro and in vivo stress conditions
RNA-seq analysis to identify genes affected by rnfG deletion
This comprehensive approach would parallel established methodologies used to study other E. ictaluri virulence factors .
The relationship between RnfG's electron transport function and iron acquisition in E. ictaluri represents a complex area for investigation. While the search results don't directly address this relationship, we can extrapolate based on bacterial physiology principles:
Iron acquisition and utilization play a central role in bacterial growth and virulence expression . The electron transport chain (ETC) requires various electron carriers, many of which contain iron-sulfur clusters or heme groups. As part of the Rnf electron transport complex, RnfG likely participates in energy transduction that may support iron transport systems.
In E. ictaluri, the TonB energy transducing system supports active transport of scarce resources including iron . Though not directly mentioned in association with RnfG, the electron transport function could potentially provide the energy required for TonB-dependent iron uptake systems.
Research approaches to investigate this relationship could include:
Comparative proteomics of wild-type versus rnfG mutants under iron-limited conditions
Measurement of iron uptake efficiency in rnfG mutants
Analysis of expression patterns of iron acquisition genes in the presence/absence of functional RnfG
Within the catfish host, E. ictaluri encounters various environmental stressors including iron limitation, pH changes, oxidative stress, and immune responses. While the specific role of RnfG in adaptation to these stressors is not directly addressed in the search results, we can infer potential mechanisms based on similar bacterial systems:
pH Adaptation: The Rnf complex in other bacteria has been implicated in pH homeostasis through ion translocation. RnfG could potentially contribute to E. ictaluri's survival in the acidic gastric environment of catfish.
Oxidative Stress Response: Electron transport components often play roles in managing oxidative stress by balancing redox states. RnfG may participate in mechanisms that protect against host-generated reactive oxygen species.
Energy Conservation Under Stress: The Rnf complex could provide alternative pathways for energy generation when primary metabolic pathways are compromised under stress conditions.
To investigate these hypotheses, researchers could:
Compare the survival rates of wild-type and rnfG mutants under various stress conditions
Analyze gene expression changes in stress response pathways in the absence of rnfG
Measure intracellular redox states and ATP levels in rnfG mutants exposed to stressors
Researchers working with recombinant RnfG protein may encounter several technical challenges:
Designing a functional assay for RnfG requires consideration of its role in electron transport. While specific protocols for RnfG are not provided in the search results, a methodological approach based on electron transport complex analysis would include:
Membrane Potential Measurements:
Isolate bacterial membranes containing native or reconstituted RnfG
Use fluorescent dyes such as DiSC3(5) to measure membrane potential changes
Compare wild-type activity to that of point mutants or truncated RnfG variants
Electron Transfer Assays:
Employ artificial electron donors and acceptors to measure electron flow
Utilize spectrophotometric methods to track redox changes of electron carriers
Measure activity under various pH and ion concentrations to determine optimal conditions
Reconstitution in Liposomes:
Purify RnfG and other Rnf complex components
Reconstitute in proteoliposomes
Measure ion translocation coupled to electron transport
In vitro Translation/Transcription Systems:
Express RnfG in cell-free systems containing necessary cofactors
Assess activity immediately after synthesis to avoid storage issues
Understanding RnfG function can significantly impact vaccine development strategies against E. ictaluri infections in the following ways:
Attenuated Live Vaccines: Similar to the findings with hfq mutants, rnfG deletion mutants might serve as effective live attenuated vaccines. The search results indicate that EiΔhfq vaccination completely protected catfish against subsequent EiWT infection . If RnfG is similarly important for virulence but not essential for growth outside the host, an EiΔrnfG strain could potentially serve as a safe and effective vaccine candidate.
Subunit Vaccine Development: If specific epitopes of RnfG are exposed on the bacterial surface or are immunogenic, recombinant RnfG protein could be incorporated into subunit vaccines. The availability of purified recombinant RnfG facilitates testing this approach.
Cross-Protection Assessment: Given the high conservation of Rnf proteins within the Edwardsiella genus, vaccines targeting RnfG might provide protection against multiple Edwardsiella species. The search results note high conservation of Hfq within the Edwardsiella genus , and similar conservation patterns might exist for RnfG.
Adjuvant Development: Understanding the immunostimulatory properties of RnfG could inform its potential use as an adjuvant in vaccine formulations.
Conducting comparative analyses between RnfG and other characterized E. ictaluri virulence factors would provide valuable insights into pathogenesis mechanisms:
Comparison with TonB System:
Comparison with Hfq Chaperone:
Comparative Virulence Attenuation:
Comparative Host Immune Responses:
Profile immune responses elicited by different mutants
Determine which mutant provides optimal protective immunity
These comparative analyses would help establish the relative contribution of RnfG to E. ictaluri pathogenesis in the context of other known virulence factors.
Several promising research directions could further our understanding of RnfG function in bacterial pathogenesis:
Systems Biology Approach: Implement comprehensive -omics analyses (transcriptomics, proteomics, metabolomics) comparing wild-type and rnfG mutants to map the complete network of cellular processes affected by RnfG.
Structure-Function Relationships: Determine the three-dimensional structure of RnfG to identify functional domains and potential interaction sites with other proteins. The full-length recombinant protein available would facilitate such studies.
Host-Pathogen Interaction Studies: Investigate how RnfG affects the interaction between E. ictaluri and host immune cells, particularly macrophages, given that E. ictaluri is a facultative intracellular pathogen .
Comparative Genomics: Extend the analysis to RnfG homologs in related fish pathogens to determine conserved functions and species-specific adaptations.
Environmental Adaptation: Study how RnfG contributes to adaptation to various environmental conditions found in aquaculture settings, which could inform prevention strategies.
CRISPR-Cas9 technology offers powerful approaches for studying RnfG function beyond traditional gene deletion methods:
Precise Genetic Modifications:
Create point mutations in specific functional domains of RnfG
Generate truncated versions to identify essential regions
Introduce tagged versions at the native locus for localization studies
CRISPRi for Conditional Knockdowns:
Implement inducible repression of rnfG expression
Study phenotypes at different expression levels
Investigate essential functions that might be masked in complete knockout studies
CRISPR Screens:
Perform genome-wide CRISPR screens in E. ictaluri to identify genetic interactions with rnfG
Identify compensatory pathways that become essential in the absence of RnfG
Base Editing Applications:
Introduce specific amino acid changes without double-strand breaks
Assess how specific residues contribute to protein function and interaction
In vivo Tracking:
Tag native RnfG with fluorescent proteins using precise CRISPR editing
Monitor expression and localization during infection
These advanced genetic approaches would complement traditional biochemical and physiological studies to provide a comprehensive understanding of RnfG function in E. ictaluri pathogenesis.