Recombinant Edwardsiella ictaluri Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Description

Introduction

Edwardsiella ictaluri is a Gram-negative, facultative intracellular bacterium that poses a significant threat to the catfish aquaculture industry by causing enteric septicemia of catfish (ESC) . The Rnf complex, a novel ion-motive electron transport chain, couples cellular ferredoxin to the pyridine nucleotide pool . Recombinant Edwardsiella ictaluri Electron Transport Complex Protein RnfG (RnfG) is a component of this complex .

General Information

CategoryDescription
Full NameRecombinant Full Length Edwardsiella ictaluri Electron transport complex protein RnfG(rnfG) Protein
SourceEdwardsiella ictaluri
Protein NamesElectron transport complex protein RnfG
Gene NamesrnfG
Ordered Locus NamesNT01EI_2090
Expression Region1-209
AA SequencemLTTMRRHGIRLALFAILATALTAIVHQLTTRTIAHQAALQQQRLFDQVIAPDGYDNDLQ RSCLLLRDPRLGDSSAHRLYLAQRQGQPIAALVETTAPDGYAGAIRLLVGADFSGKVLGV RVQEQHETPGLGDKIEIRISDWIDSFRNKVVHGAQDPAFRVKKDGGEFDQFTGATITPRA VVNAVRRTTLAIRDIRPHLASLPRCGESK

Rnf Complex Function and Importance

The Rnf complex is a membrane-bound, Na+-translocating ferredoxin:NAD+ oxidoreductase . It facilitates microbial adaptation to diverse environmental conditions by coupling the cellular ferredoxin to the pyridine nucleotide pool .

ictaluri and Virulence Factors

E. ictaluri employs various secretion systems that contribute to its virulence . Research has identified several virulence factors in E. ictaluri, including the hcp, fldA, wzx, fhuC, and ureE genes, all of which were found in the tested isolates . The presence of the eseJ and traD genes varied among isolates, indicating genetic diversity within E. ictaluri populations .

Regulation of Type III Secretion System

The type III secretion system (T3SS) in E. ictaluri is regulated by the EsrAB two-component system . This system is essential for virulence, and its expression is influenced by environmental conditions such as low pH and phosphate limitation, mimicking the phagosomal environment .

Role of Hfq Protein

The RNA chaperone Hfq plays a multifaceted role in E. ictaluri and significantly impacts bacterial growth . Deletion of hfq results in a reduced growth rate during the late exponential phase, highlighting its importance in the bacterium's life cycle .

Genetic Diversity

Genetic diversity among E. ictaluri isolates indicates that populations circulating in specific regions have changed over time . Isolates recovered between 2001 and 2011 showed different genetic characteristics compared to those recovered after 2017 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
rnfG; NT01EI_2090; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
NT01EI_2090
Target Protein Sequence
MLTTMRRHGIRLALFAILATALTAIVHQLTTRTIAHQAALQQQRLFDQVIAPDGYDNDLQ RSCLLLRDPRLGDSSAHRLYLAQRQGQPIAALVETTAPDGYAGAIRLLVGADFSGKVLGV RVQEQHETPGLGDKIEIRISDWIDSFRNKVVHGAQDPAFRVKKDGGEFDQFTGATITPRA VVNAVRRTTLAIRDIRPHLASLPRCGESK
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the RnfG protein in Edwardsiella ictaluri and what is its function?

The RnfG protein (rnfG) is a component of the electron transport complex in Edwardsiella ictaluri, a Gram-negative facultative intracellular bacterium that causes enteric septicemia in catfish (ESC). The protein functions as part of the ion-translocating oxidoreductase complex, specifically as the subunit G of the Rnf electron transport complex . This complex plays a crucial role in energy metabolism of the bacterium, contributing to its survival and pathogenicity mechanisms within the host environment.

How does the RnfG protein relate to other virulence factors in E. ictaluri?

While the search results don't directly discuss RnfG's specific relationship to other virulence factors, we can contextualize it within E. ictaluri's pathogenic mechanisms. E. ictaluri employs multiple virulence factors including those involved in iron acquisition systems, which are essential during infection . As a component of an electron transport complex, RnfG likely contributes to energy production necessary for virulence expression. Other documented virulence factors in E. ictaluri include the RNA chaperone Hfq, which facilitates gene regulation via small RNAs and affects bacterial growth, motility, biofilm formation, stress response, and virulence in catfish .

What are the optimal storage and handling conditions for recombinant RnfG protein?

For optimal preservation of recombinant RnfG protein stability and activity, adhere to the following conditions:

Storage ParameterRecommended Condition
Storage Temperature-20°C to -80°C for long-term storage
Working Storage4°C for up to one week
Physical FormLyophilized powder (as supplied)
Reconstitution BufferDeionized sterile water
Recommended Concentration0.1-1.0 mg/mL
CryoprotectantAdd glycerol to 5-50% final concentration
Default Glycerol Concentration50%
pHStorage buffer at pH 8.0 (Tris/PBS-based)
Freeze-Thaw CyclesAvoid repeated freeze-thaw cycles

Before opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, aliquot the protein to minimize repeated freeze-thaw cycles which can compromise protein integrity .

How should I design experiments to study the role of RnfG in E. ictaluri pathogenesis?

When designing experiments to investigate RnfG's role in E. ictaluri pathogenesis, consider implementing the following methodological approaches:

  • Gene Deletion Studies: Create an in-frame deletion mutant of the rnfG gene (EiΔrnfG) using techniques similar to those employed for hfq or tonB deletion in E. ictaluri . This would typically involve:

    • Constructing a suicide plasmid containing upstream and downstream regions of the rnfG gene

    • Transferring the plasmid into E. ictaluri via conjugation

    • Selecting for plasmid integration using appropriate antibiotics

    • Allowing for the second allelic exchange and selecting with sucrose

    • Confirming deletion using PCR and sequencing

  • Phenotypic Characterization:

    • Growth kinetics in both iron-replete and iron-depleted conditions

    • Stress response assays (acidic, oxidative stress)

    • Motility assays

    • Biofilm formation capacity

    • Macrophage survival assays using catfish peritoneal macrophages

  • In vivo Virulence Assessment:

    • Infection model using catfish to assess bacterial persistence

    • Comparative survival rates between wild-type and mutant strains

    • Potential protective effects of attenuated strains against subsequent wild-type infection

  • Expression Analysis:

    • Measure rnfG expression under various in vitro and in vivo stress conditions

    • RNA-seq analysis to identify genes affected by rnfG deletion

This comprehensive approach would parallel established methodologies used to study other E. ictaluri virulence factors .

How does the electron transport function of RnfG relate to iron acquisition in E. ictaluri?

The relationship between RnfG's electron transport function and iron acquisition in E. ictaluri represents a complex area for investigation. While the search results don't directly address this relationship, we can extrapolate based on bacterial physiology principles:

Iron acquisition and utilization play a central role in bacterial growth and virulence expression . The electron transport chain (ETC) requires various electron carriers, many of which contain iron-sulfur clusters or heme groups. As part of the Rnf electron transport complex, RnfG likely participates in energy transduction that may support iron transport systems.

In E. ictaluri, the TonB energy transducing system supports active transport of scarce resources including iron . Though not directly mentioned in association with RnfG, the electron transport function could potentially provide the energy required for TonB-dependent iron uptake systems.

Research approaches to investigate this relationship could include:

  • Comparative proteomics of wild-type versus rnfG mutants under iron-limited conditions

  • Measurement of iron uptake efficiency in rnfG mutants

  • Analysis of expression patterns of iron acquisition genes in the presence/absence of functional RnfG

What is the role of RnfG in E. ictaluri adaptation to environmental stressors within the host?

Within the catfish host, E. ictaluri encounters various environmental stressors including iron limitation, pH changes, oxidative stress, and immune responses. While the specific role of RnfG in adaptation to these stressors is not directly addressed in the search results, we can infer potential mechanisms based on similar bacterial systems:

  • pH Adaptation: The Rnf complex in other bacteria has been implicated in pH homeostasis through ion translocation. RnfG could potentially contribute to E. ictaluri's survival in the acidic gastric environment of catfish.

  • Oxidative Stress Response: Electron transport components often play roles in managing oxidative stress by balancing redox states. RnfG may participate in mechanisms that protect against host-generated reactive oxygen species.

  • Energy Conservation Under Stress: The Rnf complex could provide alternative pathways for energy generation when primary metabolic pathways are compromised under stress conditions.

To investigate these hypotheses, researchers could:

  • Compare the survival rates of wild-type and rnfG mutants under various stress conditions

  • Analyze gene expression changes in stress response pathways in the absence of rnfG

  • Measure intracellular redox states and ATP levels in rnfG mutants exposed to stressors

What are common challenges when working with recombinant RnfG protein and how can they be addressed?

Researchers working with recombinant RnfG protein may encounter several technical challenges:

ChallengeSolution
Low protein solubility- Optimize buffer conditions (pH, ionic strength)
- Add solubility enhancers (glycerol, mild detergents)
- Consider solubility tags beyond His-tag
- Express as fusion protein with solubility enhancers like MBP
Protein inactivity after reconstitution- Ensure proper folding through gradual temperature changes
- Add stabilizing agents to storage buffer
- Verify pH is maintained at 8.0
- Minimize freeze-thaw cycles
Protein aggregation- Filter solutions before use
- Centrifuge after thawing to remove aggregates
- Optimize protein concentration (typically 0.1-1.0 mg/mL)
- Add 5-50% glycerol as recommended
Contamination issues- Work under sterile conditions
- Use sterile-filtered buffers
- Add preservatives for longer storage at 4°C
Poor antibody recognition- Ensure epitopes are accessible
- Try different antibody clones
- Consider native vs. denatured detection methods

How can I design a functional assay to assess RnfG activity in electron transport?

Designing a functional assay for RnfG requires consideration of its role in electron transport. While specific protocols for RnfG are not provided in the search results, a methodological approach based on electron transport complex analysis would include:

  • Membrane Potential Measurements:

    • Isolate bacterial membranes containing native or reconstituted RnfG

    • Use fluorescent dyes such as DiSC3(5) to measure membrane potential changes

    • Compare wild-type activity to that of point mutants or truncated RnfG variants

  • Electron Transfer Assays:

    • Employ artificial electron donors and acceptors to measure electron flow

    • Utilize spectrophotometric methods to track redox changes of electron carriers

    • Measure activity under various pH and ion concentrations to determine optimal conditions

  • Reconstitution in Liposomes:

    • Purify RnfG and other Rnf complex components

    • Reconstitute in proteoliposomes

    • Measure ion translocation coupled to electron transport

  • In vitro Translation/Transcription Systems:

    • Express RnfG in cell-free systems containing necessary cofactors

    • Assess activity immediately after synthesis to avoid storage issues

How can understanding RnfG function contribute to vaccine development against E. ictaluri?

Understanding RnfG function can significantly impact vaccine development strategies against E. ictaluri infections in the following ways:

  • Attenuated Live Vaccines: Similar to the findings with hfq mutants, rnfG deletion mutants might serve as effective live attenuated vaccines. The search results indicate that EiΔhfq vaccination completely protected catfish against subsequent EiWT infection . If RnfG is similarly important for virulence but not essential for growth outside the host, an EiΔrnfG strain could potentially serve as a safe and effective vaccine candidate.

  • Subunit Vaccine Development: If specific epitopes of RnfG are exposed on the bacterial surface or are immunogenic, recombinant RnfG protein could be incorporated into subunit vaccines. The availability of purified recombinant RnfG facilitates testing this approach.

  • Cross-Protection Assessment: Given the high conservation of Rnf proteins within the Edwardsiella genus, vaccines targeting RnfG might provide protection against multiple Edwardsiella species. The search results note high conservation of Hfq within the Edwardsiella genus , and similar conservation patterns might exist for RnfG.

  • Adjuvant Development: Understanding the immunostimulatory properties of RnfG could inform its potential use as an adjuvant in vaccine formulations.

What comparative analyses between RnfG and other E. ictaluri virulence factors would be most informative?

Conducting comparative analyses between RnfG and other characterized E. ictaluri virulence factors would provide valuable insights into pathogenesis mechanisms:

  • Comparison with TonB System:

    • Compare growth phenotypes of rnfG and tonB mutants in iron-depleted conditions

    • Assess whether RnfG and TonB function in the same or parallel pathways for iron acquisition

    • Determine if double mutations have synergistic effects on virulence attenuation

  • Comparison with Hfq Chaperone:

    • Analyze transcriptomic profiles of rnfG and hfq mutants to identify overlapping regulons

    • Compare stress response phenotypes between the mutants

    • Evaluate if RnfG is regulated by Hfq-dependent small RNAs

  • Comparative Virulence Attenuation:

    • The search results indicate that tonB mutation caused a 2.16-fold reduction in virulence , while hfq deletion significantly attenuated virulence

    • A direct comparison of virulence attenuation between rnfG, tonB, and hfq mutants would establish their relative importance

  • Comparative Host Immune Responses:

    • Profile immune responses elicited by different mutants

    • Determine which mutant provides optimal protective immunity

These comparative analyses would help establish the relative contribution of RnfG to E. ictaluri pathogenesis in the context of other known virulence factors.

What are promising research areas for further elucidating RnfG function in bacterial pathogenesis?

Several promising research directions could further our understanding of RnfG function in bacterial pathogenesis:

  • Systems Biology Approach: Implement comprehensive -omics analyses (transcriptomics, proteomics, metabolomics) comparing wild-type and rnfG mutants to map the complete network of cellular processes affected by RnfG.

  • Structure-Function Relationships: Determine the three-dimensional structure of RnfG to identify functional domains and potential interaction sites with other proteins. The full-length recombinant protein available would facilitate such studies.

  • Host-Pathogen Interaction Studies: Investigate how RnfG affects the interaction between E. ictaluri and host immune cells, particularly macrophages, given that E. ictaluri is a facultative intracellular pathogen .

  • Comparative Genomics: Extend the analysis to RnfG homologs in related fish pathogens to determine conserved functions and species-specific adaptations.

  • Environmental Adaptation: Study how RnfG contributes to adaptation to various environmental conditions found in aquaculture settings, which could inform prevention strategies.

How might techniques like CRISPR-Cas9 advance our understanding of RnfG function?

CRISPR-Cas9 technology offers powerful approaches for studying RnfG function beyond traditional gene deletion methods:

  • Precise Genetic Modifications:

    • Create point mutations in specific functional domains of RnfG

    • Generate truncated versions to identify essential regions

    • Introduce tagged versions at the native locus for localization studies

  • CRISPRi for Conditional Knockdowns:

    • Implement inducible repression of rnfG expression

    • Study phenotypes at different expression levels

    • Investigate essential functions that might be masked in complete knockout studies

  • CRISPR Screens:

    • Perform genome-wide CRISPR screens in E. ictaluri to identify genetic interactions with rnfG

    • Identify compensatory pathways that become essential in the absence of RnfG

  • Base Editing Applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Assess how specific residues contribute to protein function and interaction

  • In vivo Tracking:

    • Tag native RnfG with fluorescent proteins using precise CRISPR editing

    • Monitor expression and localization during infection

These advanced genetic approaches would complement traditional biochemical and physiological studies to provide a comprehensive understanding of RnfG function in E. ictaluri pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.