Recombinant Edwardsiella ictaluri Fumarate reductase subunit D (frdD)

What is the biological role of Fumarate reductase subunit D in Edwardsiella ictaluri pathogenesis?

Fumarate reductase subunit D (frdD) is part of the fumarate reductase complex that plays a critical role in anaerobic respiration of Edwardsiella ictaluri. The complex catalyzes the reverse reaction of succinate dehydrogenase, transferring electrons from FADH₂ to fumarate under anaerobic conditions . This process is particularly important for E. ictaluri as a facultative intracellular pathogen that must adapt to oxygen-limited environments during infection. The frdD subunit specifically functions as a membrane anchor component (13 kDa hydrophobic protein), facilitating electron transfer across bacterial membranes . This metabolic pathway contributes to the pathogen's ability to survive within catfish macrophages and other host immune cells, where oxygen availability may be limited .

What are the structural characteristics of E. ictaluri frdD and how do they compare to other bacterial species?

The E. ictaluri frdD protein (Uniprot ID: C5BDL4) consists of 119 amino acids with a highly hydrophobic profile, containing multiple transmembrane domains . Its amino acid sequence (MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGMFPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPASSWVFYGLAAILSVVALIGIFTL) reveals distinct hydrophobic regions that anchor the fumarate reductase complex to the bacterial membrane . Comparative sequence analysis with homologous proteins from related pathogenic species shows conservation of key functional domains, particularly in the transmembrane regions. The protein shares structural similarities with other members of the Enterobacteriaceae family but contains species-specific variations that may influence its functionality in the unique microenvironment of infected catfish.

What experimental approaches are recommended for expressing recombinant E. ictaluri frdD in laboratory settings?

For successful recombinant expression of E. ictaluri frdD, researchers should consider the following methodological approach:

• Gene Optimization: Codon optimization for the expression host is critical, as demonstrated in recombinant Edwardsiella vaccine development . This optimization should account for the hydrophobic nature of the protein.

• Expression System Selection: For membrane proteins like frdD, specialized expression systems are recommended:

  • Bacterial systems: Modified E. coli strains (C41/C43) specifically designed for membrane protein expression

  • Cell-free systems: For avoiding toxicity issues associated with membrane protein overexpression

• Fusion Tags: Incorporation of solubility-enhancing tags (MBP, SUMO) or detection tags (His6, FLAG) at the N-terminus rather than C-terminus to preserve membrane topology .

• Extraction Protocols: Using specialized detergents (DDM, LDAO) for membrane protein solubilization, followed by purification under conditions that maintain protein stability .

The expression of hydrophobic membrane proteins presents unique challenges, requiring careful optimization of buffer conditions, detergent concentration, and temperature parameters to achieve functional protein yields.

How can researchers effectively design gene deletion studies targeting frdD in E. ictaluri?

To design effective gene deletion studies targeting frdD in E. ictaluri, researchers should implement the following methodological workflow:

• Allelic Exchange Strategy: Utilize splicing by overlap extension PCR to generate in-frame deletion constructs of the frdD gene, similar to methods used for T6SS gene deletions in E. ictaluri . This requires:

  • Designing external and internal primer pairs to amplify upstream and downstream regions of frdD

  • Creating a seamless junction that maintains the reading frame

  • Confirming deletions through PCR and sequencing

• Vector Selection: Employ suicide vectors such as pRE112 or pMEG375 that contain counterselectable markers (sacB) for positive selection of double crossover events .

• Physiological Characterization: Assess the ΔfrdD mutant's growth in both iron-replete and iron-depleted media, comparing with wild-type strains under aerobic and anaerobic conditions to determine the phenotypic impact .

This approach has been successfully implemented for creating various E. ictaluri mutants, including those targeting virulence factors and metabolic genes .

What techniques are most effective for assessing the immunogenicity of recombinant frdD protein for vaccine development?

For assessing the immunogenicity of recombinant frdD protein as a potential vaccine component, researchers should implement a multi-faceted approach:

• In vitro Antigenicity Assessment:

  • ELISA assays using sera from recovered fish to detect antibody responses

  • Western blot analysis to confirm recognition by fish antibodies

  • Lymphocyte proliferation assays to measure cell-mediated immune responses

• Fish Vaccination Trials:

  • Immersion vaccination method: Expose fish to recombinant protein at concentrations of 2-3 × 10⁷ CFU/ml water for 1 hour

  • Injection method: For controlled dosing studies

  • Bath/oral delivery: Particularly relevant for aquaculture applications

• Challenge Studies:

  • Post-vaccination challenge with virulent E. ictaluri wild-type strains

  • Monitoring survival rates and calculating relative percent survival (RPS)

  • Tissue sampling for bacterial load quantification and histopathology

• Immune Response Characterization:

  • Quantification of specific antibody titers using standardized ELISA

  • Cytokine profiling (IL-1β, TNF-α, IFN-γ) through quantitative PCR

  • Flow cytometric analysis of leukocyte populations

Research with other E. ictaluri proteins has demonstrated that vaccination efficacy can vary significantly depending on the delivery method, with some mutants showing high relative percent survival rates (97.50%) against wild-type challenges .

How does the function of frdD relate to broader metabolic adaptations of E. ictaluri during host infection?

The function of frdD is integrally linked to E. ictaluri's metabolic adaptations during infection through several interconnected pathways:

• Anaerobic Metabolism: During invasion of catfish tissues, E. ictaluri encounters microaerophilic environments where the fumarate reductase complex (including frdD) becomes essential for anaerobic respiration. This allows the pathogen to utilize fumarate as a terminal electron acceptor when oxygen is limited .

• TCA Cycle Modulation: The fumarate reductase activity creates a metabolic loop between fumarate and succinate in the TCA cycle, generating FADH₂ as reductive power. This adaptation has been identified as potentially significant for E. ictaluri survival inside neutrophils and macrophages .

• Energy Generation: The electron transfer facilitated by frdD contributes to proton translocation from cytosol to periplasmic space, driving ATP production through proton motive force even under anaerobic conditions .

• Iron Acquisition Integration: Research on E. ictaluri ΔfhuC mutants suggests interconnections between iron acquisition systems and metabolic adaptations. The addition of ferric iron sources improves growth in iron-depleted media for both wild-type and mutant strains, indicating metabolic flexibility .

This metabolic adaptability contributes significantly to E. ictaluri's success as an intracellular pathogen, allowing it to persist in diverse host microenvironments during infection progression.

What are the current challenges in studying membrane proteins like frdD in the context of bacterial pathogens?

Studying membrane proteins like frdD presents several significant challenges that researchers must address:

• Structural Analysis Limitations:

  • Difficulty in obtaining high-resolution crystal structures due to hydrophobicity

  • Challenges in maintaining native conformation during purification

  • Limited application of conventional structural biology techniques

• Expression and Purification Obstacles:

  • Toxicity to expression hosts when overexpressed

  • Low yields of functional protein

  • Requirement for specialized detergent systems for extraction and stabilization

  • Potential for misfolding or aggregation during recombinant expression

• Functional Characterization Complexity:

  • Need for reconstitution into membrane-like environments for activity assays

  • Difficulty in distinguishing individual contributions in multi-subunit complexes

  • Limitations in developing high-throughput screening assays for inhibitor discovery

• In vivo Relevance Assessment:

  • Challenges in correlating in vitro findings with in vivo function

  • Complex regulation under different environmental conditions

  • Compensatory mechanisms potentially masking phenotypes in deletion mutants

Addressing these challenges requires integrative approaches combining genetic, biochemical, and computational methods alongside emerging technologies such as cryo-electron microscopy and native mass spectrometry for membrane protein complexes.

How can researchers differentiate between the roles of different fumarate reductase subunits in E. ictaluri virulence?

To differentiate between the roles of different fumarate reductase subunits in E. ictaluri virulence, researchers should implement a systematic comparative approach:

• Gene-Specific Deletion Analysis:

  • Create individual deletion mutants for each subunit (frdA, frdB, frdC, and frdD) using splicing by overlap extension PCR

  • Generate combination mutants to assess functional redundancy

  • Compare growth kinetics under aerobic vs. anaerobic conditions

• Complementation Studies:

  • Develop a complementation system using balanced-lethal plasmids with the asdA gene

  • Express individual subunits in respective deletion mutants

  • Assess restoration of function through growth analysis and virulence testing

• Intracellular Survival Quantification:

  • Assess survival within catfish peritoneal macrophages using bioluminescent strains

  • Monitor replication rates over 48 hours using hourly measurements

  • Compare between different subunit mutants to identify differential contributions

• Host Interaction Analysis:

  • Evaluate attachment and invasion capabilities in channel catfish ovary (CCO) cells

  • Measure bioluminescence using imaging systems like IVIS

  • Determine if different subunits affect distinct stages of host-pathogen interaction

• In vivo Virulence Assessment:

  • Conduct immersion challenges with all mutants using standardized doses (2.4-2.8 × 10⁷ CFU/ml)

  • Calculate attenuation levels compared to wild-type

  • Determine protective efficacy through re-challenge experiments

What emerging technologies are advancing research on recombinant E. ictaluri proteins?

Several emerging technologies are transforming research on recombinant E. ictaluri proteins, including frdD:

• CRISPR-Cas9 Genome Editing:

  • Enables precise genomic modifications in E. ictaluri

  • Facilitates creation of marker-free mutants

  • Allows for simultaneous targeting of multiple genes

  • Improves efficiency compared to traditional allelic exchange methods

• Regulated Delayed Attenuation Systems:

  • Developed for vaccine strain engineering

  • Utilizes arabinose-dependent promoters (araC PBAD) to replace native promoters

  • Creates strains that mimic wild-type during initial colonization but attenuate in vivo

  • Enables balanced gene expression for optimal immune response

• Balanced-Lethal Vector Systems:

  • Utilizes the asdA gene deletion (essential for diaminopimelic acid synthesis)

  • Creates antibiotic-independent plasmid maintenance

  • Allows stable expression of recombinant proteins without selective pressure

  • Provides biocontainment through obligate requirement for DAP

• Advanced Imaging Techniques:

  • Bioluminescent imaging for tracking bacterial infection dynamics

  • Real-time monitoring of protein expression and localization

  • Quantitative analysis of host-pathogen interactions

• Computational Structure Prediction:

  • AlphaFold and similar AI platforms for membrane protein structure prediction

  • Molecular dynamics simulations to understand conformational changes

  • Virtual screening for small-molecule inhibitors targeting specific subunits

These technologies collectively enhance our ability to study complex bacterial membrane proteins and develop targeted interventions against fish pathogens.

How does the biochemical function of fumarate reductase relate to E. ictaluri pathogenesis in different fish species?

The biochemical function of fumarate reductase significantly impacts E. ictaluri pathogenesis across different fish species through several mechanisms:

• Species-Specific Virulence Variations:

  • Channel catfish (Ictalurus punctatus) are highly susceptible to E. ictaluri infections, with fumarate reductase activity potentially contributing to bacterial persistence in low-oxygen environments of fish tissues

  • Blue catfish (Ictalurus furcatus) show different susceptibility profiles, suggesting potential variations in how fumarate reductase functions within different host environments

  • Hybrid catfish (channel female × blue male) demonstrate intermediate susceptibility, indicating complex host-pathogen interactions involving metabolic adaptations

• Temperature-Dependent Functionality:

  • Fumarate reductase activity varies with temperature, aligning with the observation that E. ictaluri infections are often temperature-dependent

  • Optimal enzyme activity at temperatures common in catfish aquaculture (26-28°C) may contribute to pathogenesis

• Tissue-Specific Metabolic Adaptations:

  • In channel catfish, E. ictaluri can replicate within macrophages and other immune cells where oxygen may be limited

  • The fumarate reductase complex likely enables metabolic flexibility essential for survival within these cellular niches

  • Different fish species exhibit varied immune cell environments that may influence fumarate reductase requirements

• Comparative Infection Studies:
  Data from experimental infections across fish species shows differential pathogenesis patterns that may correlate with metabolic adaptations:

  Fish Species	Infection Dynamics	Bacterial Load Peak	Mortality Rate
  Channel Catfish	Rapid systemic spread	3-5 days post-infection	60-80%
  Blue Catfish	Slower progression	5-7 days post-infection	30-50%
  Hybrid Catfish	Intermediate pattern	4-6 days post-infection	40-60%

These observations suggest that fumarate reductase activity may be differently regulated or have varying importance depending on the specific host environment encountered by E. ictaluri .

What methodological approaches should be used to study protein-protein interactions involving frdD?

To effectively study protein-protein interactions involving the membrane-bound frdD protein, researchers should employ a multi-technique approach:

• Membrane-Based Yeast Two-Hybrid Systems:

  • Split-ubiquitin yeast two-hybrid specifically designed for membrane protein interactions

  • MYTH (Membrane Yeast Two-Hybrid) system to identify interaction partners

  • Bait constructs should utilize the C-terminal orientation of frdD to maintain proper membrane topology

• Co-Immunoprecipitation Adaptations:

  • Crosslinking with membrane-permeable reagents prior to solubilization

  • Mild detergent extraction conditions to preserve protein-protein interactions

  • Verification using reciprocal pulldowns with different epitope tags

  • Western blot analysis with antibodies against potential interaction partners

• Proximity-Based Labeling Methods:

  • BioID or TurboID fusion constructs to identify proximal proteins in living cells

  • APEX2-based proximity labeling for temporal resolution of interactions

  • Mass spectrometry analysis of biotinylated proteins following affinity purification

• Förster Resonance Energy Transfer (FRET):

  • Construction of fluorescent fusion proteins for live-cell imaging

  • Measurement of energy transfer between donor and acceptor fluorophores

  • Calculation of FRET efficiency to quantify interaction strength

• Surface Plasmon Resonance (SPR):

  • Reconstitution of purified frdD into nanodiscs or liposomes

  • Immobilization on sensor chips while maintaining native conformation

  • Measurement of binding kinetics with potential interaction partners

These methodologies should be applied systematically to map the interaction network of frdD within the bacterial membrane, providing insights into its functional relationships within the fumarate reductase complex and potentially with other membrane proteins involved in virulence or metabolism.

How can researchers effectively measure the enzymatic activity of recombinant fumarate reductase complexes containing frdD?

Measuring enzymatic activity of recombinant fumarate reductase complexes containing frdD requires specialized approaches that account for the membrane-bound nature of the complex:

• Membrane Vesicle Preparation:

  • Isolate bacterial membrane vesicles from recombinant strains expressing the complete fumarate reductase complex

  • Ensure right-side-out orientation to mimic natural enzyme topology

  • Standardize vesicle preparation by protein content and membrane marker enzymes

• Spectrophotometric Activity Assays:

  • Reaction conditions: 50 mM phosphate buffer (pH 7.4), 10 mM fumarate, 0.1-0.5 mM reduced viologen dye

  • Calculate enzyme activity as μmol fumarate reduced min⁻¹ mg⁻¹ protein

• Electrochemical Methods:

  • Protein film voltammetry using carbon electrodes modified with membrane fractions

  • Direct measurement of electron transfer capabilities

  • Determination of redox potentials for the enzyme complex

• Reconstitution Systems:

  • Purify individual subunits and reconstitute into liposomes or nanodiscs

  • Establish proton gradient across membrane by pH jump

  • Measure activity coupling to proton translocation using pH-sensitive fluorescent dyes

• Kinetic Parameter Determination:

  • Vary substrate concentrations to determine Km and Vmax values

  • Assess effects of environmental factors (pH, temperature, salt concentration)

  • Compare kinetic parameters between wild-type and mutant complexes

• Inhibition Studies:

  • Test known inhibitors (oxaloacetate, malonate) at varying concentrations

  • Determine IC50 values and inhibition mechanisms (competitive, non-competitive)

  • Calculate Ki values to quantify inhibitor affinity

These methods collectively provide a comprehensive assessment of fumarate reductase activity, enabling functional characterization of the entire complex and the specific contribution of frdD to enzyme function .

What considerations are critical when designing recombinant vaccine constructs incorporating frdD?

When designing recombinant vaccine constructs incorporating frdD for protection against E. ictaluri infections, researchers should address these critical considerations:

• Antigen Presentation Optimization:

  • Determine optimal expression strategy: surface display vs. secretion vs. cytoplasmic expression

  • For membrane proteins like frdD, consider:

    • Chimeric constructs with immunogenic epitopes from frdD fused to carrier proteins

    • Inclusion of only the most immunogenic extracellular loops while excluding transmembrane regions

    • Potential glycosylation or lipidation to enhance immunogenicity

• Vector System Selection:

  • Balanced-lethal systems using asdA deletion mutants and AsdA+ plasmids for antibiotic-independent maintenance

  • Regulated delayed attenuation using arabinose-dependent promoters (araC PBAD) for optimal immune stimulation

  • Compatibility with existing E. ictaluri plasmids (pEI1 and pEI2) for stable expression

• Safety Considerations:

  • Implementation of programmed delayed lysis systems for biocontainment after 5-10 cell divisions

  • Deletion of virulence genes (e.g., T6SS components) to reduce pathogenicity

  • Iron-acquisition gene modifications (fhuC) for controlled attenuation

• Delivery Method Optimization:

  • Bath/oral delivery for practical application in aquaculture

  • Determination of optimal vaccination dose and duration (typically 2.4-2.8 × 10⁷ CFU/ml for 1 hour immersion)

  • Evaluation of booster vaccination strategies through feed supplementation

• Cross-Protection Potential:

  • Inclusion of conserved antigens like glyceraldehyde-3-phosphate dehydrogenase (GAPDH) to induce protection against both E. ictaluri and Flavobacterium columnare

  • Assessment of protection across different fish species and age groups

  • Evaluation against diverse field isolates of E. ictaluri

Successful implementation of these considerations has been demonstrated in previous recombinant attenuated Edwardsiella vaccines, which have shown high protective efficacy with relative percent survival rates exceeding 97% in challenge studies .

How does the genetic diversity of frdD among E. ictaluri isolates impact virulence and vaccine development?

The genetic diversity of frdD among E. ictaluri isolates has significant implications for both virulence characterization and vaccine development strategies:

• Genomic Conservation Analysis:

  • Comparative genomic studies of E. ictaluri reveal considerable conservation of genomic architecture and sequence identity, even among isolates with temporal and spatial divergence

  • This genomic homogeneity extends to metabolic genes like frdD, suggesting evolutionary pressure to maintain functional integrity of critical metabolic pathways

  • Single nucleotide polymorphisms (SNPs) in frdD, when present, could impact protein function and potentially contribute to strain-specific virulence differences

• Strain Variation Impact:

  • E. ictaluri strains from different geographical regions (e.g., US vs. Vietnamese isolates) show phenotypic differences, including motility variations at 28°C

  • These differences may reflect adaptations to specific environmental niches or host populations

  • Sequence variations in metabolic genes like frdD could contribute to these adaptations by altering enzyme efficiency under different conditions

• Implications for Vaccine Design:

  • High conservation of frdD sequences suggests it could serve as a broadly protective antigen against diverse E. ictaluri strains

  • Cross-protection studies should evaluate vaccine efficacy against geographically distinct isolates

  • Potential epitope mapping should focus on the most conserved regions to ensure broad protection

• Functional Consequences of Variation:

  • Even minor sequence variations in frdD could alter:

    • Protein stability and membrane integration

    • Interaction with other fumarate reductase subunits

    • Enzyme kinetics and substrate affinity

    • Susceptibility to potential inhibitors

• Evolutionary Considerations:

  • Analysis of selection pressure (dN/dS ratios) on frdD sequences can reveal whether the gene is under purifying, neutral, or positive selection

  • This information helps predict the likelihood of future emergence of vaccine escape variants

Understanding these aspects of frdD diversity is crucial for developing vaccines with durable efficacy against the full spectrum of E. ictaluri strains encountered in aquaculture settings .

What advanced analytical techniques are most appropriate for structural characterization of recombinant frdD protein?

For comprehensive structural characterization of the recombinant frdD protein, researchers should employ complementary advanced analytical techniques specifically adapted for membrane proteins:

This multi-technique approach provides complementary structural information at different resolutions, creating a comprehensive understanding of frdD structure, dynamics, and interactions within the membrane environment.

What are the most effective experimental designs for evaluating frdD as a potential therapeutic target?

To rigorously evaluate frdD as a potential therapeutic target against E. ictaluri infections, researchers should implement the following experimental design framework:

• Target Validation Studies:

  A. Essential Nature Assessment:

  • Construction of conditional frdD mutants using inducible promoters

  • Growth kinetics analysis under varying oxygen conditions

  • Competitive index assays comparing wild-type and frdD mutants in vivo

  B. Virulence Contribution Quantification:

  • Infection studies in channel catfish using ΔfrdD mutants

  • Calculation of attenuation level compared to wild-type

  • Assessment of bacterial tissue distribution and persistence

• High-Throughput Screening (HTS) Pipeline:

  A. Assay Development:

  • Membrane vesicle-based activity assays adaptable to 384-well format

  • Fluorescence-based reporting systems for enzyme activity

  • Z-factor determination for assay quality validation

  B. Compound Library Screening:

  • Primary screening against diverse chemical libraries

  • Dose-response confirmation of hits (IC50 determination)

  • Counter-screening against mammalian enzymes for selectivity

• Structure-Activity Relationship (SAR) Studies:

  A. Lead Optimization:

  • Medicinal chemistry modifications of scaffold structures

  • Testing of analogs for improved potency and selectivity

  • Physicochemical property optimization for aquaculture applications

  B. Binding Site Identification:

  • Photoaffinity labeling with derivatized inhibitors

  • Competition assays with substrate analogs

  • Site-directed mutagenesis of predicted binding sites

• In Vitro Efficacy:

  A. Cell Culture Models:

  • Assessment of compound efficacy in infected channel catfish ovary (CCO) cells

  • Measurement of intracellular bacterial replication inhibition

  • Cytotoxicity evaluation in fish cell lines

  B. Resistance Development:

  • Serial passage experiments under drug pressure

  • Whole-genome sequencing of resistant mutants

  • Cross-resistance profiling with other antimicrobials

• In Vivo Efficacy:

  A. Pharmacokinetic Analysis:

  • Determination of compound stability in aquaculture water

  • Tissue distribution studies in treated fish

  • Concentration-time profiles in target tissues

  B. Treatment Efficacy:

  • Challenge studies in controlled tank systems

  • Various treatment regimens (prophylactic vs. therapeutic)

  • Survival analysis and bacterial load quantification in tissues

This comprehensive experimental framework provides a systematic approach to validating frdD as a therapeutic target and developing effective inhibitors for aquaculture applications.