Recombinant Edwardsiella ictaluri NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Edwardsiella ictaluri NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Edwardsiella ictaluri NADH-quinone oxidoreductase subunit K (nuoK), also known as NDH-1 subunit K, is a full-length recombinant protein derived from the bacterium Edwardsiella ictaluri. It is a critical component of bacterial Complex I (NADH dehydrogenase I), a multi-subunit enzyme in the electron transport chain that transfers electrons from NADH to quinones while pumping protons across the membrane, contributing to ATP synthesis .

This recombinant protein is engineered with an N-terminal histidine (His) tag for purification and is expressed in Escherichia coli. Its primary applications include biochemical research, vaccine development, and studies on bacterial pathogenesis .

Key Technical Parameters

ParameterValue/DescriptionSource
Genbank/UniProt IDC5B8H7
Protein LengthFull-length (1–100 amino acids)
TagN-terminal His tag
Expression HostE. coli
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (lyophilized); avoid freeze-thaw cycles

Enzyme Activity and Quinone Interactions

In Salmonella, Complex I activity is measured via:

  • dNADH-oxidase activity: Depends on endogenous quinone pools.

  • dNADH-DB activity: Uses exogenous ubiquinone analogs (e.g., DB).

  • dNADH-K₃Fe(CN)₆ reductase activity: Assesses dehydrogenase domain function .

For Edwardsiella ictaluri nuoK, similar assays could evaluate its role in electron transfer, though experimental data remain pending.

Pathogen Studies

Edwardsiella ictaluri is a fish pathogen causing enteric septicemia of catfish (ESC). While nuoK itself is not directly implicated in virulence, its study contributes to understanding bacterial energy metabolism under stress conditions (e.g., low pH, phosphate limitation) .

Vaccine Development

Recombinant proteins like nuoK may serve as antigens or components in vaccine vectors. For example, Edwardsiella’s asdA gene deletion paired with balanced-lethal systems has been explored for live-attenuated vaccine platforms .

Emerging Research Directions

  1. Antimicrobial Targeting: Inhibiting Complex I activity could disrupt bacterial respiration. Capsaicin derivatives (e.g., capsaicin-40) show promise as NDH-1 inhibitors .

  2. Structural Biology: Crystallographic studies on nuoK could reveal quinone-binding motifs, aiding drug design.

  3. Host-Pathogen Interactions: Investigating nuoK’s role in Edwardsiella’s adaptation to host environments (e.g., macrophage phagosomes) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NT01EI_2670; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFALGLTGLLIRRNLLFMLISLEIMINAAALAFVVAGSVWGQADGQV MYILAISLAAAEASIGLALLLQLHRRRNTLNIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation (four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Edwardsiella ictaluri and why is it significant in aquaculture research?

Edwardsiella ictaluri is a gram-negative bacterium belonging to the Enterobacteriaceae family. It is the causative agent of enteric septicemia of catfish (ESC), a fatal disease that significantly impacts the catfish aquaculture industry. ESC costs the industry millions of dollars in losses annually, with estimates ranging from $50-80 million . E. ictaluri's significance in research stems from its ability to replicate intracellularly within catfish head-kidney-derived macrophages (HKDM) and its sophisticated mechanisms for evading host immune responses .

The bacterium employs a Type III Secretion System (T3SS) that is crucial for both its virulence and intracellular replication capabilities. This system translocates effectors from the Edwardsiella containing vacuole (ECV) through the bacterial cell wall and vacuolar membrane directly to the host cytoplasm . Understanding the molecular mechanisms behind E. ictaluri's pathogenicity is essential for developing effective control strategies for ESC.

How does the structure of recombinant nuoK protein differ from native nuoK?

The recombinant version of E. ictaluri nuoK protein described in the literature features a full-length construct (amino acids 1-100) with an N-terminal histidine tag . This His-tag modification facilitates protein purification through metal affinity chromatography but represents a structural difference from the native protein.

FeatureNative nuoKRecombinant nuoK
Length100 amino acids100 amino acids (plus His-tag)
N-terminusNatural N-terminusHis-tag modification
Expression systemE. ictaluriE. coli
Cellular localizationMembrane-embeddedDepends on expression conditions
Post-translational modificationsPotentially presentMay differ from native protein

When designing experiments using recombinant nuoK, researchers should consider how the His-tag might affect protein folding, membrane insertion, or interactions with other proteins. While the tag is essential for purification, it may influence structure-function relationships in experimental settings .

What expression systems are optimal for producing recombinant E. ictaluri nuoK protein?

Based on documented methods, E. coli expression systems have been successfully employed for recombinant production of E. ictaluri nuoK protein . When designing an expression strategy, researchers should consider the following methodological approaches:

Expression System Selection:

  • BL21(DE3) or similar E. coli strains designed for membrane protein expression

  • Expression vectors with tightly controlled inducible promoters (T7, tac, or arabinose-inducible systems)

  • Consideration of codon optimization for heterologous expression

Optimization Parameters:

  • Induction temperature (often lowered to 16-25°C for membrane proteins)

  • Inducer concentration

  • Duration of induction

  • Media composition (potentially including osmolytes or membrane stabilizers)

For membrane proteins like nuoK, expression conditions that are too aggressive often lead to inclusion body formation. A balanced approach with moderate induction at lower temperatures may yield better results for obtaining properly folded protein .

What are the recommended protocols for purification and storage of recombinant nuoK?

The purification and storage of recombinant nuoK requires careful consideration of its membrane protein characteristics. Based on established protocols for similar proteins and specific information about nuoK, the following methodological approach is recommended:

Purification Protocol:

  • Cell lysis: Gentle lysis using methods suitable for membrane proteins (e.g., French press, sonication with mild detergents)

  • Membrane isolation: Ultracentrifugation to separate membrane fractions

  • Solubilization: Use of appropriate detergents (DDM, LDAO, or other mild detergents)

  • IMAC purification: Utilizing the His-tag for metal affinity chromatography

  • Size exclusion chromatography: For further purification and buffer exchange

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • For reconstituted protein, add 5-50% glycerol (final concentration)

  • The protein can be maintained as a lyophilized powder for long-term storage

For working stocks, store aliquots at 4°C for up to one week to minimize degradation from repeated freeze-thaw cycles .

What reconstitution methods ensure optimal activity of recombinant nuoK?

The reconstitution of lyophilized recombinant nuoK protein requires careful handling to preserve structure and function. The following methodological approach is recommended based on documented protocols:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) for long-term storage

  • Prepare multiple small-volume aliquots to minimize freeze-thaw cycles

For functional studies, researchers may need to consider reconstitution into artificial membrane systems such as liposomes or nanodiscs to better mimic the native membrane environment of nuoK. This is particularly important for functional assays assessing electron transport or proton translocation activities.

How might nuoK contribute to E. ictaluri pathogenesis and immune evasion?

While direct experimental evidence linking nuoK specifically to E. ictaluri pathogenesis mechanisms is not extensively documented in the provided literature, we can formulate research hypotheses based on the known pathogenic mechanisms of E. ictaluri and the role of respiratory chain components in bacterial virulence:

E. ictaluri evades host immune responses through multiple mechanisms, including:

  • Suppression of the CD40 pathway that is critical for T cell-dependent activation

  • Evasion of programmed cell death mechanisms in host cells

  • Intracellular replication within macrophages

As a component of the bacterial respiratory chain, nuoK might contribute to these processes by:

  • Supporting energy production necessary for intracellular survival and replication

  • Contributing to maintenance of membrane potential, which can affect various virulence mechanisms

  • Potentially playing a role in adaptation to the intracellular environment of macrophages, where nutrient availability and oxygen tension differ from extracellular conditions

Methodologically, researchers investigating this relationship could design experiments using nuoK knockout mutants or strains with regulated expression of nuoK to assess impacts on:

What potential does nuoK have as a target for vaccine development against E. ictaluri?

The potential of nuoK as a vaccine target can be analyzed in the context of ongoing vaccine development efforts against E. ictaluri. Current approaches include:

  • Live recombinant attenuated Edwardsiella vaccines (RAEV) that display:

    • Regulated delayed attenuation

    • Induction of cross-protective immunity

    • Regulated delayed lysis for biocontainment

  • An EseK knockout strain that provides catfish fingerlings with protection against subsequent wild-type exposure

The potential of nuoK as a vaccine target depends on several factors:

FactorConsideration for nuoK
ImmunogenicityAs a membrane protein, nuoK may have limited exposure to the immune system
ConservationIf highly conserved across E. ictaluri strains, could provide broad protection
EssentialityIf essential for survival, mutations would be less likely to emerge
AccessibilityMembrane localization may limit accessibility to antibodies

Methodologically, researchers could:

  • Evaluate immune responses to recombinant nuoK protein in fish models

  • Test protective efficacy of nuoK-based subunit vaccines

  • Consider including nuoK in broader multi-antigen vaccine approaches

  • Explore whether nuoK could be genetically modified in live attenuated vaccines

What experimental approaches are appropriate for studying nuoK interactions with other bacterial proteins?

Understanding the interactions between nuoK and other bacterial proteins requires sophisticated experimental approaches suitable for membrane proteins. Recommended methodological approaches include:

In vitro Interaction Studies:

  • Pull-down assays using His-tagged nuoK as bait

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Cross-linking studies followed by mass spectrometry

  • Surface plasmon resonance with reconstituted proteins

Structural Studies:

  • Cryo-electron microscopy of the entire NADH-quinone oxidoreductase complex

  • X-ray crystallography (challenging for membrane proteins)

  • NMR studies of specific domains or interactions

In vivo Approaches:

  • Fluorescence resonance energy transfer (FRET) with tagged proteins

  • Suppressor mutation analysis

  • Co-immunoprecipitation from bacterial lysates

  • Genetic approaches using interacting-domain mapping

When designing these experiments, researchers should consider the hydrophobic nature of nuoK and ensure that experimental conditions maintain its native conformation, potentially through the use of appropriate detergents or membrane mimetics.

What are common challenges in recombinant nuoK expression and how can they be addressed?

Membrane proteins like nuoK present several experimental challenges. Here are methodological approaches to address common issues:

ChallengeTroubleshooting Approach
Poor expression yields- Optimize codon usage for expression host
- Test different promoter strengths
- Reduce induction temperature (16-25°C)
- Use specialized E. coli strains (C41/C43, Lemo21)
Inclusion body formation- Lower induction levels
- Add membrane-stabilizing compounds
- Use fusion partners that enhance solubility
- Consider refolding protocols if necessary
Protein aggregation- Optimize detergent selection
- Screen buffer conditions (pH, salt, additives)
- Add glycerol to stabilize (5-50%)
- Avoid repeated freeze-thaw cycles
Loss of activity- Minimize time at room temperature
- Use gentle purification methods
- Reconstitute into lipid environments
- Include reducing agents if appropriate

For efficient troubleshooting, researchers should implement systematic approaches, changing one variable at a time and documenting outcomes carefully. Small-scale expression trials can be valuable for optimizing conditions before scaling up production.

How can researchers validate the functional integrity of purified recombinant nuoK?

Validating that purified recombinant nuoK maintains its native structural and functional properties is critical for experimental reliability. Recommended methodological approaches include:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Size exclusion chromatography to verify monodispersity

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate stability

  • Functional Analysis:

    • Reconstitution into proteoliposomes for proton pumping assays

    • NADH oxidation activity measurements in reconstituted systems

    • Membrane potential measurements using fluorescent probes

    • Electron transfer assays with artificial electron acceptors

  • Interaction Studies:

    • Binding assays with known interaction partners

    • Assembly into partial or complete complex I structures

    • Detergent micelle incorporation efficiency

When validating recombinant nuoK, researchers should compare results with known properties of the native protein or homologous proteins from related species when direct data on E. ictaluri nuoK is limited.

What controls are essential when studying nuoK in the context of E. ictaluri pathogenesis?

Genetic Studies:

  • Clean deletion mutants with confirmed genotype

  • Complementation strains to verify phenotype restoration

  • Point mutations in key residues rather than full deletions

  • Inducible expression systems to control timing and level of expression

Pathogenesis Models:

  • Wild-type E. ictaluri strains as positive controls

  • Known attenuated strains as reference points

  • Mutations in unrelated genes to control for general fitness effects

  • Host cell controls (uninfected, infected with other pathogens)

Specific for Macrophage Interaction Studies:

  • Non-activated head-kidney-derived macrophages (HKDMs)

  • Controls for M1 phenotype induction independent of nuoK

  • Assessment of CD40 pathway functionality

  • Monitoring of programmed cell death pathways

When examining nuoK's potential contribution to immune evasion, researchers should pay special attention to the CD40 pathway and T cell responses, as E. ictaluri is known to manipulate these systems during infection .

How might high-throughput methodologies advance nuoK research?

While traditional biochemical and molecular biology approaches have provided valuable insights into membrane proteins like nuoK, emerging high-throughput methodologies offer new opportunities for accelerated discovery. Researchers should consider:

  • Systems Biology Approaches:

    • Transcriptomics to identify co-regulated genes under different conditions

    • Proteomics to map the complete interactome of nuoK

    • Metabolomics to assess the impact of nuoK manipulation on bacterial metabolism

  • High-Throughput Structural Studies:

    • Cryo-EM for structure determination at near-atomic resolution

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Deep mutational scanning to map functional residues

  • Advanced Computational Methods:

    • Molecular dynamics simulations of nuoK in membrane environments

    • Machine learning approaches to predict functional impacts of mutations

    • Integrative modeling combining multiple experimental data types

These approaches can complement traditional methods and potentially identify unexpected roles for nuoK in E. ictaluri biology and pathogenesis that might be missed by hypothesis-driven research alone.

What is the potential for nuoK as a target for antimicrobial development?

Given the essential role of the respiratory chain in bacterial energy metabolism, nuoK and related components represent potential targets for novel antimicrobial strategies. Researchers exploring this direction should consider:

  • Target Validation Approaches:

    • Conditional knockdown strains to confirm essentiality

    • Fitness studies under different growth conditions

    • Assessment of metabolic bypass pathways

  • Inhibitor Discovery Strategies:

    • Structure-based virtual screening for binding pocket identification

    • Fragment-based drug discovery approaches

    • Phenotypic screening with target deconvolution

  • Therapeutic Index Considerations:

    • Comparison with homologous proteins in host species

    • Selectivity assessment against related bacterial species

    • Evaluation of resistance development potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.