Recombinant Edwardsiella ictaluri Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; NT01EI_0142; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
ubiB
Target Protein Sequence
MTPSELRRLCLIIRVFLAYGLDELIPLMRITLPLRIGRRCLFWMRNRHGDKPLGERLRLA LQTLGPVWIKFGQMLSTRRDLFAPAIADQLALLQDRVAPFDGALARRQIEASLGGPLEQW FDDFDSQALASASIAQVHTATLRENGREVVLKVIRPDIQPIIRADVRLMYRLAGWVPKLL PDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDASPMLYIPEVFSDYCRESVL VMERIYGVPVSDIAALRAQNTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP QDPQYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNIEEFEF AIRTVCEPIFEKPLDQISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWTTAKPFLENWLHDQVGLPALMRALKAKAPYWSEKLPELPELLYDSLQQQRRLQHS MDSMTHRLGQQGSRQGRARYLFGIGATLLLSGTILTMVNIALWPIGLYVAGGVIWLAGWR YTR
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the ubiquinone biosynthesis protein UbiB in Edwardsiella ictaluri?

UbiB in E. ictaluri is a protein involved in ubiquinone (coenzyme Q) biosynthesis, essential for bacterial electron transfer chains. Based on homology with other bacterial species, E. ictaluri UbiB likely functions as an accessory factor in the ubiquinone biosynthetic pathway rather than as a direct enzymatic component . The protein is encoded by the ubiB gene (also annotated as aarF, yigQ, or yigR in various databases) and shares significant sequence similarity with UbiB proteins in other Enterobacterales . The recombinant form is typically expressed with ≥85% purity as determined by SDS-PAGE .

What expression systems are recommended for producing recombinant E. ictaluri UbiB protein?

For laboratory-scale expression of recombinant E. ictaluri UbiB, several expression systems have proven effective:

Expression SystemAdvantagesLimitationsTypical Yield
Cell-free expressionRapid production, avoids toxicity issuesLimited post-translational modificationsVariable (0.5-1 mg/mL)
E. coli BL21(DE3)High yield, economicalInclusion body formation common5-10 mg/L culture
Yeast systemsBetter folding for complex proteinsLonger production time2-5 mg/L culture

For E. ictaluri UbiB specifically, cell-free expression systems have been successfully employed to produce recombinant protein with ≥85% purity . When using E. coli as an expression host, optimization of growth conditions (temperature, induction timing, media composition) is critical to maximize soluble protein yield and minimize inclusion body formation.

What purification strategies are most effective for isolating recombinant E. ictaluri UbiB protein?

Purification of recombinant E. ictaluri UbiB requires a strategic approach due to its membrane association properties. A recommended multi-step purification protocol includes:

  • Cell lysis optimization: For membrane-associated proteins like UbiB, use detergent-based lysis buffers containing 1% Triton X-100 or 0.5% CHAPS in Tris-HCl buffer (pH 8.0) with 300 mM NaCl.

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein, with elution using an imidazole gradient (50-500 mM).

  • Secondary purification: Size exclusion chromatography using Superdex 200 column to separate monomeric protein from aggregates.

  • Quality assessment: Purity evaluation by SDS-PAGE (target ≥85%) and functional verification through activity assays .

For E. ictaluri UbiB specifically, maintaining 0.05% detergent throughout purification helps prevent aggregation. Inclusion body solubilization, if necessary, can be achieved using 8M urea with subsequent refolding by gradual dialysis against decreasing concentrations of urea buffer.

How can researchers assess the functional activity of purified recombinant E. ictaluri UbiB?

Functional characterization of E. ictaluri UbiB requires multiple complementary approaches:

  • Ubiquinone biosynthesis complementation assay: Transform E. coli ubiB knockout strains with E. ictaluri ubiB and assess restoration of ubiquinone biosynthesis by HPLC analysis of cellular ubiquinone content.

  • ATP binding and hydrolysis assays: Measure ATPase activity using colorimetric phosphate release assays with increasing concentrations of ATP (0.1-5 mM) to determine kinetic parameters.

  • Protein-protein interaction studies: Investigate UbiB-UbiJ complex formation using pull-down assays or surface plasmon resonance with recombinant UbiJ protein.

  • Lipid binding assays: Assess interaction with palmitoleic acid using fluorescence-based assays, as the UbiK-UbiJ complex in E. coli has been shown to interact with this lipid .

Most importantly, researchers should validate functional assays using appropriate controls: wild-type protein, catalytically inactive mutants (e.g., ATP-binding site mutants), and related proteins from other bacterial species.

What are the key considerations for analyzing E. ictaluri UbiB protein structure?

Structural analysis of E. ictaluri UbiB requires multiple complementary techniques:

  • Secondary structure analysis: Circular dichroism spectroscopy can determine α-helical and β-sheet content, similar to the approach used for characterizing the chimeric EiCh protein in E. ictaluri .

  • Tertiary structure prediction: Ab initio protein modeling approaches using tools like I-TASSER or SWISS-MODEL can predict tertiary structure based on homology to known UbiB structures.

  • X-ray crystallography considerations: For crystallization attempts, protein concentration of 5-10 mg/mL in detergent-stabilized form is recommended, with screening against 384-1536 crystallization conditions.

  • Cryo-EM as an alternative: For membrane-associated proteins like UbiB that resist crystallization, single-particle cryo-EM can be employed, especially if the protein forms higher-order complexes.

When designing structural studies, researchers should account for the potential membrane association of UbiB and consider the inclusion of lipids or detergents that stabilize the native conformation.

What genetic approaches can be used to study E. ictaluri UbiB regulation in response to environmental conditions?

E. ictaluri gene expression is known to respond to environmental cues that mimic host conditions. To study ubiB regulation:

  • Transcriptional reporter fusions: Create ubiB promoter fusions to reporter genes (GFP, luciferase) to monitor expression under various conditions:

    • Low pH (5.5) environments that mimic phagosomal conditions

    • Phosphate limitation, which induces E. ictaluri Type III Secretion System

    • Various temperatures (20-30°C) spanning the range of catfish rearing temperatures

  • RNA-Seq analysis: Perform global transcriptomic analysis comparing wild-type E. ictaluri under standard conditions versus stress conditions (pH, temperature, nutrient limitation) to identify co-regulated genes and potential regulatory networks involving ubiB.

  • ChIP-Seq approaches: Identify transcription factors that bind the ubiB promoter region using chromatin immunoprecipitation followed by sequencing.

  • Regulatory mutant analysis: Examine ubiB expression in mutants lacking key regulatory systems like EsrA/EsrB, which control virulence gene expression in E. ictaluri .

Establishing the regulatory network controlling ubiB expression will provide insights into how E. ictaluri adapts its energy metabolism during infection processes.

How might E. ictaluri UbiB be exploited for vaccine development against ESC?

Exploiting UbiB for vaccine development requires assessment of its immunogenic potential and protective efficacy:

  • Epitope prediction and analysis: Use immunoinformatic approaches similar to those employed for the multi-epitope chimeric EiCh protein :

    • Identify potential B-cell epitopes within UbiB

    • Screen for MHC class II epitopes with high binding affinity

    • Engineer a chimeric protein containing selected epitopes

  • Recombinant vaccine design strategies:

    • Direct immunization with purified recombinant UbiB protein

    • Inclusion of UbiB epitopes in multivalent vaccines

    • Development of Recombinant Attenuated Edwardsiella Vaccine (RAEV) strains expressing modified UbiB

  • Delivery system optimization: Test different routes of administration:

    • Bath immersion vaccination (highly practical for aquaculture)

    • Oral delivery through feed (economical for boosting immunization)

    • Injectable formats for maximum controlled dosing

  • Protection assessment: Challenge studies in channel catfish to determine:

    • Antibody production (serum agglutination titers)

    • Relative percent survival (RPS) compared to non-vaccinated controls

    • Cross-protection against diverse E. ictaluri strains

The RAEV platform described by USDA researchers provides an excellent framework for developing live attenuated vaccines with regulated delayed attenuation that could incorporate UbiB antigens .

What experimental controls should be included when studying E. ictaluri UbiB protein function?

Robust experimental design for E. ictaluri UbiB functional studies requires comprehensive controls:

  • Genetic complementation controls:

    • ΔubiB mutant (negative control)

    • ΔubiB + wild-type ubiB (positive control)

    • ΔubiB + catalytically inactive ubiB (e.g., ATP-binding site mutant)

    • ΔubiB + heterologous ubiB (e.g., from E. coli) to assess functional conservation

  • Protein activity assay controls:

    • Heat-inactivated UbiB protein (95°C for 10 minutes)

    • UbiB protein with competitive inhibitors (if known)

    • Related proteins from the same family with distinct functions

  • Specificity controls for interaction studies:

    • Unrelated proteins of similar size/charge characteristics

    • Truncated UbiB variants to map interaction domains

    • Competition assays with unlabeled protein to demonstrate specificity

  • In vivo infection controls:

    • Wild-type E. ictaluri (virulent strain)

    • Known attenuated E. ictaluri strain (e.g., ESC vaccine strain)

    • Unrelated catfish pathogen (e.g., Flavobacterium columnare)

These controls ensure that observed phenotypes are specifically attributable to UbiB function rather than experimental artifacts or secondary effects.

How should researchers approach the genetic manipulation of E. ictaluri ubiB for functional studies?

Genetic manipulation of E. ictaluri ubiB can be approached using established methodologies adapted from studies of other E. ictaluri genes:

  • Gene deletion strategy:

    • Create in-frame deletions using suicide vectors with counterselection markers (e.g., sacB)

    • Design primers to amplify ~500 bp upstream and downstream of target regions

    • Verify recombinants by PCR and DNA sequencing

  • Site-directed mutagenesis approach:

    • Target conserved residues based on alignment with characterized UbiB proteins

    • Focus on putative ATP-binding residues or catalytic sites

    • Use overlap extension PCR to introduce specific mutations

  • Complementation systems:

  • Expression control methods:

    • Implement arabinose-inducible promoter systems (araC PBAD) for regulated expression

    • Develop systems with regulated delayed attenuation for in vivo studies

    • Use native promoter for physiologically relevant expression levels

When manipulating genes potentially essential for growth like ubiB, researchers should consider conditional mutants or partial deletions to ensure viability while studying function.

What bioinformatic approaches are most useful for analyzing E. ictaluri UbiB in the context of pathogenesis research?

Comprehensive bioinformatic analysis of E. ictaluri UbiB can provide valuable insights:

  • Comparative genomic analysis:

    • Align ubiB sequences across E. ictaluri strains to identify conservation patterns

    • Compare with other Edwardsiella species (E. tarda, E. piscicida) to identify species-specific features

    • Examine ubiB in diverse pathogens including Salmonella and E. coli to identify shared virulence-associated features

  • Structural prediction and analysis:

    • Generate 3D models using homology modeling and ab initio approaches

    • Identify potential druggable pockets for inhibitor design

    • Map conserved residues onto structural models to identify functional domains

  • Genetic context analysis:

    • Examine the genomic neighborhood of ubiB to identify co-regulated genes

    • Compare operon structure across bacterial species

    • Identify regulatory elements in the promoter region

  • Population genomic analysis:

    • Analyze ubiB sequence variation across E. ictaluri isolates from different:

      • Geographic regions (e.g., Vietnamese vs. US isolates)

      • Host species (channel catfish vs. striped catfish)

      • Temporal collections to identify evolutionary patterns

Recent studies of Vietnamese E. ictaluri isolates using pulsed-field gel electrophoresis and plasmid analysis revealed genetic diversity patterns that could inform similar approaches for studying ubiB gene evolution .

How might systems biology approaches enhance our understanding of E. ictaluri UbiB function?

Systems biology approaches offer comprehensive insights into UbiB function:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to map UbiB's impact on cellular networks

    • Compare wild-type and ΔubiB mutants under various environmental conditions

    • Identify compensatory pathways activated in response to ubiB mutation

  • Flux balance analysis:

    • Develop metabolic models of E. ictaluri with and without functional UbiB

    • Predict metabolic bottlenecks and vulnerabilities

    • Identify potential synthetic lethal interactions with other genes

  • Protein-protein interaction network mapping:

    • Use pull-down assays coupled with mass spectrometry to identify UbiB interaction partners

    • Validate key interactions using techniques like bacterial two-hybrid systems

    • Map the complete "UbiB interactome" to understand its functional context

  • Host-pathogen interaction modeling:

    • Simulate how UbiB function impacts bacterial survival in macrophage environments

    • Model metabolic adaptations during host infection

    • Predict therapeutic intervention points based on systems-level analysis

This integrative approach would place UbiB in its broader biological context and potentially identify non-obvious functional relationships relevant to pathogenesis.

What potential exists for developing UbiB-targeted antimicrobial strategies against E. ictaluri?

The essential role of ubiquinone in bacterial energy metabolism makes UbiB a promising antimicrobial target:

  • Structure-based drug design opportunities:

    • Once crystal structures are available, perform virtual screening of compound libraries against predicted binding pockets

    • Design small molecule inhibitors targeting ATP-binding or protein-protein interaction sites

    • Optimize lead compounds for specificity to bacterial UbiB over host homologs

  • Target validation approaches:

    • Create conditional knockdowns of ubiB to confirm essentiality under various conditions

    • Assess impact of partial inhibition on bacterial fitness in vitro and in vivo

    • Determine resistance development frequency and mechanisms

  • Combination therapy potential:

    • Test UbiB inhibitors in combination with existing antibiotics

    • Identify synergistic combinations that enhance efficacy or reduce resistance development

    • Develop dual-targeting strategies affecting both UbiB and other metabolic pathways

  • Delivery systems for aquaculture applications:

    • Design feed-incorporated formulations for oral delivery

    • Develop water-soluble preparations for bath treatments

    • Optimize dosing regimens for efficient treatment with minimal environmental impact

UbiB-targeted therapeutics could provide alternatives to traditional antibiotics for controlling ESC in aquaculture settings, potentially addressing concerns about antibiotic resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.